Citrus Sinensis ID: 032460

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140
MLQLSCNLHRPSQPLLLPRHYLSPISFPINHVKFNVNKEFVKITKIWTAIGAKKGGDRSSEEGANSEKWVHEGFITESLPNGMFRVRLDNEDLILGYISGKIRQNFIRVLPGDRVRVEVSRYDTSKGRIIYRLRNKISSD
ccccccccccccccEEEccccccccccccccccccccEEEEEcEEEEEccccccccccccccccccccEEEEEEEEEEccccEEEEEEccccEEEEEEcccEEEEEEEccccccEEEEEccccccccEEEEEEccccccc
ccEEEccccccccccEccccccccccccccccccccccccccccccHHHHcccccccccccccccccEEEEEEEEEccccccEEEEEEccccEEEEEEccHHHHcEEEEccccEEEEEEccccccccEEEEEEccccccc
mlqlscnlhrpsqplllprhylspisfpinhvkfnvnKEFVKITKIWTAIgakkggdrsseegansekwvhegfiteslpngmfrvrldnEDLILGYISGKIRQnfirvlpgdrvrvevsrydtskgrIIYRLRNKISSD
mlqlscnlhrpsqplLLPRHYLSPISFPINHVKFNVNKEFVKITKIWTaigakkggdrsseegansekwvhegfiteslpngmFRVRLDNEDLILGYIsgkirqnfirvlpgdrvrvevsrydtskgriiyrlrnkissd
MLQLSCNLHRPSQPLLLPRHYLSPISFPINHVKFNVNKEFVKITKIWTAIGAKKGGDRSSEEGANSEKWVHEGFITESLPNGMFRVRLDNEDLILGYISGKIRQNFIRVLPGDRVRVEVSRYDTSKGRIIYRLRNKISSD
*************PLLLPRHYLSPISFPINHVKFNVNKEFVKITKIWTAIGA***************KWVHEGFITESLPNGMFRVRLDNEDLILGYISGKIRQNFIRVLPGDRVRVEVSRYDTSKGRIIYRL*******
*********RPSQPLLLPRHYLSPISFPINHVKFNVNKEFVK***************************VHEGFITESLPNGMFRVRLDNEDLILGYISGKIRQNFIRVLPGDRVRVEVSRYDTSKGRII***R******
MLQLSCNLHRPSQPLLLPRHYLSPISFPINHVKFNVNKEFVKITKIWTAIG***************EKWVHEGFITESLPNGMFRVRLDNEDLILGYISGKIRQNFIRVLPGDRVRVEVSRYDTSKGRIIYRLRNKISSD
*LQLSCNLHRPSQPLLLPRHYLSPISFPINHVKFNVNKEFVKITKIWTAIGAK**********ANSEKWVHEGFITESLPNGMFRVRLDNEDLILGYISGKIRQNFIRVLPGDRVRVEVSRYDTSKGRIIYRLRN*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLQLSCNLHRPSQPLLLPRHYLSPISFPINHVKFNVNKEFVKITKIWTAIGAKKGGDRSSEEGANSEKWVHEGFITESLPNGMFRVRLDNEDLILGYISGKIRQNFIRVLPGDRVRVEVSRYDTSKGRIIYRLRNKISSD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query140 2.2.26 [Sep-21-2011]
A6MM7177 Translation initiation fa N/A no 0.528 0.961 0.824 2e-31
Q95GM377 Translation initiation fa N/A no 0.528 0.961 0.810 3e-31
Q94PL377 Translation initiation fa N/A no 0.528 0.961 0.810 4e-31
Q7ICQ577 Translation initiation fa N/A no 0.528 0.961 0.810 4e-31
Q95GN377 Translation initiation fa N/A no 0.528 0.961 0.824 4e-31
Q95GM477 Translation initiation fa N/A no 0.528 0.961 0.810 5e-31
Q95GM577 Translation initiation fa N/A no 0.528 0.961 0.797 6e-31
Q332U277 Translation initiation fa N/A no 0.528 0.961 0.797 6e-31
Q1KXS477 Translation initiation fa N/A no 0.528 0.961 0.797 6e-31
A0A37077 Translation initiation fa N/A no 0.528 0.961 0.810 6e-31
>sp|A6MM71|IF1C_BUXMI Translation initiation factor IF-1, chloroplastic OS=Buxus microphylla GN=infA PE=3 SV=1 Back     alignment and function desciption
 Score =  134 bits (336), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 61/74 (82%), Positives = 72/74 (97%)

Query: 67  EKWVHEGFITESLPNGMFRVRLDNEDLILGYISGKIRQNFIRVLPGDRVRVEVSRYDTSK 126
           +KW+HEG ITESLPNGMFRVRLDNEDLILGY+SGKIR++FIR+LPGDRV++EVSRYD+S+
Sbjct: 4   QKWIHEGLITESLPNGMFRVRLDNEDLILGYVSGKIRRSFIRILPGDRVKIEVSRYDSSR 63

Query: 127 GRIIYRLRNKISSD 140
           GRIIYRLRNK S+D
Sbjct: 64  GRIIYRLRNKDSND 77
No specific function has so far been attributed to this initiation factor; however, it seems to stimulate more or less all the activities of the other two initiation factors, IF-2 and IF-3.
Buxus microphylla (taxid: 153571)
>sp|Q95GM3|IF1C_BOROF Translation initiation factor IF-1, chloroplastic OS=Borago officinalis GN=infA PE=3 SV=2 Back     alignment and function description
>sp|Q94PL3|IF1C_MONCA Translation initiation factor IF-1, chloroplastic OS=Montinia caryophyllacea GN=infA PE=3 SV=1 Back     alignment and function description
>sp|Q7ICQ5|IF1C_FOUSP Translation initiation factor IF-1, chloroplastic OS=Fouquieria splendens GN=infA PE=3 SV=1 Back     alignment and function description
>sp|Q95GN3|IF1C_CERJA Translation initiation factor IF-1, chloroplastic OS=Cercidiphyllum japonicum GN=infA PE=3 SV=1 Back     alignment and function description
>sp|Q95GM4|IF1C_GAREL Translation initiation factor IF-1, chloroplastic OS=Garrya elliptica GN=infA PE=3 SV=1 Back     alignment and function description
>sp|Q95GM5|IF1C_SAMCA Translation initiation factor IF-1, chloroplastic OS=Sambucus canadensis GN=infA PE=3 SV=1 Back     alignment and function description
>sp|Q332U2|IF1C_LACSA Translation initiation factor IF-1, chloroplastic OS=Lactuca sativa GN=infA PE=3 SV=1 Back     alignment and function description
>sp|Q1KXS4|IF1C_HELAN Translation initiation factor IF-1, chloroplastic OS=Helianthus annuus GN=infA PE=3 SV=1 Back     alignment and function description
>sp|A0A370|IF1C_COFAR Translation initiation factor IF-1, chloroplastic OS=Coffea arabica GN=infA PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query140
357516503147 Translation initiation factor [Medicago 0.607 0.578 0.722 4e-31
1377439484 translation initiation factor IF1 [Borag 0.557 0.928 0.782 3e-30
29048691177 translational initiation factor 1 protei 0.528 0.961 0.837 7e-30
35533217291 translation initiation factor 1 [Asclepi 0.528 0.813 0.837 1e-29
14939057477 translational initiation factor 1 [Buxus 0.528 0.961 0.824 2e-29
33470235877 translational initiation factor 1 [Jacob 0.528 0.961 0.824 2e-29
37200024177 translation initiation factor 1 [Portula 0.528 0.961 0.810 2e-29
2942792377 RecName: Full=Translation initiation fac 0.528 0.961 0.810 2e-29
29048691777 translational initiation factor 1 protei 0.528 0.961 0.810 2e-29
44274299777 translation initiation factor 1 (chlorop 0.528 0.961 0.810 3e-29
>gi|357516503|ref|XP_003628540.1| Translation initiation factor [Medicago truncatula] gi|355522562|gb|AET03016.1| Translation initiation factor [Medicago truncatula] Back     alignment and taxonomy information
 Score =  139 bits (350), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 65/90 (72%), Positives = 76/90 (84%), Gaps = 5/90 (5%)

Query: 46  IWTAIGAKKGGDRSSEEGANSEKWVHEGFITESLPNGMFRVRLDNEDLILGYISGKIRQN 105
           I+T        D++SE+     KWVHEG ITESLPNGMFRVRLDNEDLILGYISG+IR+N
Sbjct: 56  IFTVAAKSSTPDKASEQ-----KWVHEGLITESLPNGMFRVRLDNEDLILGYISGRIRKN 110

Query: 106 FIRVLPGDRVRVEVSRYDTSKGRIIYRLRN 135
           ++R+LPGDRVRVEVSRYD+SKGRI+YRLRN
Sbjct: 111 YVRILPGDRVRVEVSRYDSSKGRIVYRLRN 140

Source: Medicago truncatula

Species: Medicago truncatula

Genus: Medicago

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|13774394|gb|AAK38863.1|AF347640_1 translation initiation factor IF1 [Borago officinalis] Back     alignment and taxonomy information
>gi|290486911|gb|ADD29840.1| translational initiation factor 1 protein [Nerium oleander] Back     alignment and taxonomy information
>gi|355332172|gb|AER52856.1| translation initiation factor 1 [Asclepias leptopus] Back     alignment and taxonomy information
>gi|149390574|ref|YP_001294219.1| translational initiation factor 1 [Buxus microphylla] gi|190359547|sp|A6MM71.1|IF1C_BUXMI RecName: Full=Translation initiation factor IF-1, chloroplastic gi|146762319|gb|ABQ45283.1| translational initiation factor 1 [Buxus microphylla] Back     alignment and taxonomy information
>gi|334702358|ref|YP_004465222.1| translational initiation factor 1 [Jacobaea vulgaris] gi|308156116|gb|ADO15444.1| translational initiation factor 1 [Jacobaea vulgaris] Back     alignment and taxonomy information
>gi|372000241|gb|AEX65197.1| translation initiation factor 1 [Portulaca oleracea] Back     alignment and taxonomy information
>gi|29427923|sp|Q95GM3.2|IF1C_BOROF RecName: Full=Translation initiation factor IF-1, chloroplastic Back     alignment and taxonomy information
>gi|290486917|gb|ADD29843.1| translational initiation factor 1 protein [Berberidopsis corallina] Back     alignment and taxonomy information
>gi|442742997|ref|YP_007353949.1| translation initiation factor 1 (chloroplast) [Tectona grandis] gi|438687638|emb|CCP47165.1| translation initiation factor 1 (chloroplast) [Tectona grandis] gi|438688322|emb|CCP47254.1| translation initiation factor 1 (chloroplast) [Tectona grandis] gi|438688446|emb|CCP47343.1| translation initiation factor 1 (chloroplast) [Tectona grandis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query140
TAIR|locus:2831681141 AT4G11175 [Arabidopsis thalian 0.935 0.929 0.489 1.4e-25
UNIPROTKB|P0C378107 infA "Translation initiation f 0.585 0.766 0.609 4.3e-22
UNIPROTKB|P0C379107 infA "Translation initiation f 0.585 0.766 0.609 4.3e-22
UNIPROTKB|P0C380107 infA "Translation initiation f 0.585 0.766 0.609 4.3e-22
UNIPROTKB|Q6END9107 infA "Translation initiation f 0.585 0.766 0.609 4.3e-22
TIGR_CMR|CHY_228672 CHY_2286 "translation initiati 0.435 0.847 0.655 2e-17
TIGR_CMR|BA_013372 BA_0133 "translation initiatio 0.45 0.875 0.571 1.8e-16
UNIPROTKB|P0A5H573 infA "Translation initiation f 0.45 0.863 0.571 1.6e-15
TIGR_CMR|GSU_175072 GSU_1750 "translation initiati 0.45 0.875 0.555 3.3e-15
TIGR_CMR|CPS_276572 CPS_2765 "translation initiati 0.507 0.986 0.507 5.4e-15
TAIR|locus:2831681 AT4G11175 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 290 (107.1 bits), Expect = 1.4e-25, P = 1.4e-25
 Identities = 71/145 (48%), Positives = 95/145 (65%)

Query:     1 MLQLSCNLHRPSQPLLLPRHY--LSPISFP-INHVKFNVNKEFVKITKIWTAIGAKKGGD 57
             MLQL C+  RP   LLLP  +   + +  P IN+V  N       + +   A G + G +
Sbjct:     1 MLQL-CSTFRPQ--LLLPCQFRFTNGVLIPQINYVASNSVVNIRPMIRCQRASGGRGGAN 57

Query:    58 RSS------EEGANSEKWVHEGFITESLPNGMFRVRLDNEDLILGYISGKIRQNFIRVLP 111
             RS       +EG+N  K V EG +TESLPNGMFRV L+N D ILGYI GKIR+NFIR+LP
Sbjct:    58 RSKPAKPQVKEGSN--KTVIEGLVTESLPNGMFRVDLENGDNILGYICGKIRKNFIRILP 115

Query:   112 GDRVRVEVSRYDTSKGRIIYRLRNK 136
             GD+V+VE+S YD++KGRII+R+ ++
Sbjct:   116 GDKVKVEMSVYDSTKGRIIFRMSSR 140
GO:0003723 "RNA binding" evidence=IEA;ISS
GO:0003743 "translation initiation factor activity" evidence=IEA
GO:0006413 "translational initiation" evidence=IEA
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0006354 "DNA-dependent transcription, elongation" evidence=RCA
GO:0010027 "thylakoid membrane organization" evidence=RCA
UNIPROTKB|P0C378 infA "Translation initiation factor IF-1, chloroplastic" [Oryza sativa (taxid:4530)] Back     alignment and assigned GO terms
UNIPROTKB|P0C379 infA "Translation initiation factor IF-1, chloroplastic" [Oryza sativa Indica Group (taxid:39946)] Back     alignment and assigned GO terms
UNIPROTKB|P0C380 infA "Translation initiation factor IF-1, chloroplastic" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q6END9 infA "Translation initiation factor IF-1, chloroplastic" [Oryza nivara (taxid:4536)] Back     alignment and assigned GO terms
TIGR_CMR|CHY_2286 CHY_2286 "translation initiation factor IF-1" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
TIGR_CMR|BA_0133 BA_0133 "translation initiation factor IF-1" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
UNIPROTKB|P0A5H5 infA "Translation initiation factor IF-1" [Mycobacterium tuberculosis (taxid:1773)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_1750 GSU_1750 "translation initiation factor IF-1" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_2765 CPS_2765 "translation initiation factor IF-1" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q0ZIY4IF1C_VITVINo assigned EC number0.75670.52850.9610yesno
Q94KR7IF1C_SOYBNNo assigned EC number0.74350.55710.5652yesno
O82499IF1C_ARATHNo assigned EC number0.48960.93570.9290yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query140
CHL0001078 CHL00010, infA, translation initiation factor 1 5e-42
TIGR0000869 TIGR00008, infA, translation initiation factor IF- 6e-35
PRK0027672 PRK00276, infA, translation initiation factor IF-1 2e-32
cd0445164 cd04451, S1_IF1, S1_IF1: Translation Initiation Fa 7e-30
COG036175 COG0361, InfA, Translation initiation factor 1 (IF 3e-24
pfam0117665 pfam01176, eIF-1a, Translation initiation factor 1 2e-20
PRK1244287 PRK12442, PRK12442, translation initiation factor 2e-17
smart0031672 smart00316, S1, Ribosomal protein S1-like RNA-bind 6e-08
>gnl|CDD|214332 CHL00010, infA, translation initiation factor 1 Back     alignment and domain information 
 Score =  133 bits (337), Expect = 5e-42
 Identities = 54/74 (72%), Positives = 62/74 (83%)

Query: 67  EKWVHEGFITESLPNGMFRVRLDNEDLILGYISGKIRQNFIRVLPGDRVRVEVSRYDTSK 126
            K   EG +TESLPNGMFRVRLDN   +LGYISGKIR+N IR+LPGDRV+VE+S YD +K
Sbjct: 5   NKIEMEGLVTESLPNGMFRVRLDNGCQVLGYISGKIRRNSIRILPGDRVKVELSPYDLTK 64

Query: 127 GRIIYRLRNKISSD 140
           GRIIYRLRNK S+D
Sbjct: 65  GRIIYRLRNKDSND 78

Length = 78
>gnl|CDD|188015 TIGR00008, infA, translation initiation factor IF-1 Back     alignment and domain information
>gnl|CDD|178954 PRK00276, infA, translation initiation factor IF-1; Validated Back     alignment and domain information
>gnl|CDD|239898 cd04451, S1_IF1, S1_IF1: Translation Initiation Factor IF1, S1-like RNA-binding domain Back     alignment and domain information
>gnl|CDD|223438 COG0361, InfA, Translation initiation factor 1 (IF-1) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|216345 pfam01176, eIF-1a, Translation initiation factor 1A / IF-1 Back     alignment and domain information
>gnl|CDD|237102 PRK12442, PRK12442, translation initiation factor IF-1; Reviewed Back     alignment and domain information
>gnl|CDD|197648 smart00316, S1, Ribosomal protein S1-like RNA-binding domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 140
PRK1244287 translation initiation factor IF-1; Reviewed 99.97
COG036175 InfA Translation initiation factor 1 (IF-1) [Trans 99.96
TIGR0000868 infA translation initiation factor IF-1. This fami 99.96
CHL0001078 infA translation initiation factor 1 99.93
PRK04012100 translation initiation factor IF-1A; Provisional 99.92
PRK0027672 infA translation initiation factor IF-1; Validated 99.91
cd0579377 S1_IF1A S1_IF1A: Translation initiation factor IF1 99.9
PTZ00329155 eukaryotic translation initiation factor 1A; Provi 99.89
smart0065283 eIF1a eukaryotic translation initiation factor 1A. 99.88
PLN00208145 translation initiation factor (eIF); Provisional 99.88
cd0445678 S1_IF1A_like S1_IF1A_like: Translation initiation 99.88
TIGR0052399 eIF-1A eukaryotic/archaeal initiation factor 1A. R 99.87
PF0117665 eIF-1a: Translation initiation factor 1A / IF-1; I 99.87
cd0445164 S1_IF1 S1_IF1: Translation Initiation Factor IF1, 99.76
cd0579278 S1_eIF1AD_like S1_eIF1AD_like: eukaryotic translat 99.66
KOG3403145 consensus Translation initiation factor 1A (eIF-1A 99.46
cd0446668 S1_YloQ_GTPase S1_YloQ_GTPase: YloQ GTase family ( 99.03
PRK00098 298 GTPase RsgA; Reviewed 98.62
PRK12289 352 GTPase RsgA; Reviewed 98.47
cd01854 287 YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtil 98.37
PRK12288 347 GTPase RsgA; Reviewed 98.21
PRK01889 356 GTPase RsgA; Reviewed 97.9
COG1162 301 Predicted GTPases [General function prediction onl 97.88
KOG2925167 consensus Predicted translation initiation factor 97.19
cd0568568 S1_Tex S1_Tex: The C-terminal S1 domain of a trans 95.89
cd0016465 S1_like S1_like: Ribosomal protein S1-like RNA-bin 95.79
cd0570768 S1_Rrp5_repeat_sc11 S1_Rrp5_repeat_sc11: Rrp5 is a 93.92
PF04076103 BOF: Bacterial OB fold (BOF) protein; InterPro: IP 93.75
PF11948131 DUF3465: Protein of unknown function (DUF3465); In 93.66
PF12059 202 DUF3540: Protein of unknown function (DUF3540); In 93.21
cd0569870 S1_Rrp5_repeat_hs6_sc5 S1_Rrp5_repeat_hs6_sc5: Rrp 93.19
TIGR0063869 Mop molybdenum-pterin binding domain. This model d 92.83
smart0031672 S1 Ribosomal protein S1-like RNA-binding domain. 92.68
cd0569769 S1_Rrp5_repeat_hs5 S1_Rrp5_repeat_hs5: Rrp5 is a t 92.5
PRK07252120 hypothetical protein; Provisional 92.26
cd0570673 S1_Rrp5_repeat_sc10 S1_Rrp5_repeat_sc10: Rrp5 is a 92.05
cd0569173 S1_RPS1_repeat_ec6 S1_RPS1_repeat_ec6: Ribosomal p 91.87
PF0345964 TOBE: TOBE domain; InterPro: IPR005116 The TOBE do 91.65
TIGR00156126 conserved hypothetical protein TIGR00156. As of th 91.64
PF0707661 DUF1344: Protein of unknown function (DUF1344); In 90.82
cd0445482 S1_Rrp4_like S1_Rrp4_like: Rrp4-like, S1-like RNA- 90.75
COG1098129 VacB Predicted RNA binding protein (contains ribos 90.71
PRK08582139 hypothetical protein; Provisional 90.68
cd0569269 S1_RPS1_repeat_hs4 S1_RPS1_repeat_hs4: Ribosomal p 90.48
cd0570472 S1_Rrp5_repeat_hs13 S1_Rrp5_repeat_hs13: Rrp5 is a 90.33
cd0578986 S1_Rrp4 S1_Rrp4: Rrp4 S1-like RNA-binding domain. 90.24
cd0568868 S1_RPS1_repeat_ec3 S1_RPS1_repeat_ec3: Ribosomal p 90.22
PRK08059123 general stress protein 13; Validated 90.09
cd0446183 S1_Rrp5_repeat_hs8_sc7 S1_Rrp5_repeat_hs8_sc7: Rrp 90.05
cd0445276 S1_IF2_alpha S1_IF2_alpha: The alpha subunit of tr 90.0
cd0569671 S1_Rrp5_repeat_hs4 S1_Rrp5_repeat_hs4: Rrp5 is a t 89.8
cd0570574 S1_Rrp5_repeat_hs14 S1_Rrp5_repeat_hs14: Rrp5 is a 89.58
cd0569069 S1_RPS1_repeat_ec5 S1_RPS1_repeat_ec5: Ribosomal p 89.57
PRK03987 262 translation initiation factor IF-2 subunit alpha; 89.56
cd0447183 S1_RNase_R S1_RNase_R: RNase R C-terminal S1 domai 89.46
PRK10053130 hypothetical protein; Provisional 89.35
cd0570373 S1_Rrp5_repeat_hs12_sc9 S1_Rrp5_repeat_hs12_sc9: R 89.32
PF0057574 S1: S1 RNA binding domain; InterPro: IPR003029 Rib 89.16
PF0471779 Phage_base_V: Phage-related baseplate assembly pro 89.11
cd0568770 S1_RPS1_repeat_ec1_hs1 S1_RPS1_repeat_ec1_hs1: Rib 88.91
PHA0294588 interferon resistance protein; Provisional 88.88
cd0447268 S1_PNPase S1_PNPase: Polynucleotide phosphorylase 88.82
PF15057124 DUF4537: Domain of unknown function (DUF4537) 88.61
cd0570877 S1_Rrp5_repeat_sc12 S1_Rrp5_repeat_sc12: Rrp5 is a 87.74
cd0448291 RPA2_OBF_like RPA2_OBF_like: A subgroup of unchara 86.85
cd0445567 S1_NusA S1_NusA: N-utilizing substance A protein ( 86.65
PF0273642 Myosin_N: Myosin N-terminal SH3-like domain; Inter 86.54
cd0569566 S1_Rrp5_repeat_hs3 S1_Rrp5_repeat_hs3: Rrp5 is a t 85.89
cd0568972 S1_RPS1_repeat_ec4 S1_RPS1_repeat_ec4: Ribosomal p 85.77
cd0579192 S1_CSL4 S1_CSL4: CSL4, S1-like RNA-binding domain. 85.21
PF0031366 CSD: 'Cold-shock' DNA-binding domain; InterPro: IP 84.9
PF12158148 DUF3592: Protein of unknown function (DUF3592); In 84.06
cd0448773 RecJ_OBF2_like RecJ_OBF2_like: A subfamily of OB f 82.65
cd0445388 S1_RNase_E S1_RNase_E: RNase E and RNase G, S1-lik 82.58
PRK07899 486 rpsA 30S ribosomal protein S1; Reviewed 82.28
PTZ00248 319 eukaryotic translation initiation factor 2 subunit 82.22
cd0568479 S1_DHX8_helicase S1_DHX8_helicase: The N-terminal 82.05
PRK13806 491 rpsA 30S ribosomal protein S1; Provisional 81.78
cd0446567 S1_RPS1_repeat_ec2_hs2 S1_RPS1_repeat_ec2_hs2: Rib 81.59
cd0579086 S1_Rrp40 S1_Rrp40: Rrp40 S1-like RNA-binding domai 81.19
PRK05807136 hypothetical protein; Provisional 81.19
PRK13806491 rpsA 30S ribosomal protein S1; Provisional 80.54
cd0448678 YhcR_OBF_like YhcR_OBF_like: A subfamily of OB-fol 80.52
>PRK12442 translation initiation factor IF-1; Reviewed Back     alignment and domain information 
Probab=99.97  E-value=1.6e-30  Score=187.00  Aligned_cols=75  Identities=41%  Similarity=0.673  Sum_probs=72.1

Q ss_pred             ccCCcceEEEEEEEEeCCCceEEEEeCCCCEEEEEecccccccccccCCCCEEEEEeccCCCCeEEEEEEecCCC
Q 032460           63 GANSEKWVHEGFITESLPNGMFRVRLDNEDLILGYISGKIRQNFIRVLPGDRVRVEVSRYDTSKGRIIYRLRNKI  137 (140)
Q Consensus        63 ~~k~d~ie~~GvVik~l~n~~f~V~l~dG~~~lcrI~GKmRk~~IrI~vGDrV~VE~sp~D~~kGrIiyRy~r~~  137 (140)
                      |+++|.++++|+|+++|||++|+|+|+||++++|+|+||||+++|||++||+|+||+||||+++|+|+|||+.+.
T Consensus         1 M~ke~~ie~~G~V~e~Lp~~~frV~LenG~~vla~isGKmR~~rIrIl~GD~V~VE~spYDltkGRIiyR~~~~~   75 (87)
T PRK12442          1 MAKEELIELDGIVDEVLPDSRFRVTLENGVEVGAYASGRMRKHRIRILAGDRVTLELSPYDLTKGRINFRHKDER   75 (87)
T ss_pred             CCccceEEEEEEEEEECCCCEEEEEeCCCCEEEEEeccceeeeeEEecCCCEEEEEECcccCCceeEEEEecCCC
Confidence            678899999999999999999999999999999999999999999999999999999999999999999998643

>COG0361 InfA Translation initiation factor 1 (IF-1) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00008 infA translation initiation factor IF-1 Back     alignment and domain information
>CHL00010 infA translation initiation factor 1 Back     alignment and domain information
>PRK04012 translation initiation factor IF-1A; Provisional Back     alignment and domain information
>PRK00276 infA translation initiation factor IF-1; Validated Back     alignment and domain information
>cd05793 S1_IF1A S1_IF1A: Translation initiation factor IF1A, also referred to as eIF1A in eukaryotes and aIF1A in archaea, S1-like RNA-binding domain Back     alignment and domain information
>PTZ00329 eukaryotic translation initiation factor 1A; Provisional Back     alignment and domain information
>smart00652 eIF1a eukaryotic translation initiation factor 1A Back     alignment and domain information
>PLN00208 translation initiation factor (eIF); Provisional Back     alignment and domain information
>cd04456 S1_IF1A_like S1_IF1A_like: Translation initiation factor IF1A-like, S1-like RNA-binding domain Back     alignment and domain information
>TIGR00523 eIF-1A eukaryotic/archaeal initiation factor 1A Back     alignment and domain information
>PF01176 eIF-1a: Translation initiation factor 1A / IF-1; InterPro: IPR006196 The S1 domain of around 70 amino acids, originally identified in ribosomal protein S1, is found in a large number of RNA-associated proteins Back     alignment and domain information
>cd04451 S1_IF1 S1_IF1: Translation Initiation Factor IF1, S1-like RNA-binding domain Back     alignment and domain information
>cd05792 S1_eIF1AD_like S1_eIF1AD_like: eukaryotic translation initiation factor 1A domain containing protein (eIF1AD)-like, S1-like RNA-binding domain Back     alignment and domain information
>KOG3403 consensus Translation initiation factor 1A (eIF-1A) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd04466 S1_YloQ_GTPase S1_YloQ_GTPase: YloQ GTase family (also known as YjeQ and CpgA), S1-like RNA-binding domain Back     alignment and domain information
>PRK00098 GTPase RsgA; Reviewed Back     alignment and domain information
>PRK12289 GTPase RsgA; Reviewed Back     alignment and domain information
>cd01854 YjeQ_engC YjeQ/EngC Back     alignment and domain information
>PRK12288 GTPase RsgA; Reviewed Back     alignment and domain information
>PRK01889 GTPase RsgA; Reviewed Back     alignment and domain information
>COG1162 Predicted GTPases [General function prediction only] Back     alignment and domain information
>KOG2925 consensus Predicted translation initiation factor related to eIF-1A [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd05685 S1_Tex S1_Tex: The C-terminal S1 domain of a transcription accessory factor called Tex, which has been characterized in Bordetella pertussis and Pseudomonas aeruginosa Back     alignment and domain information
>cd00164 S1_like S1_like: Ribosomal protein S1-like RNA-binding domain Back     alignment and domain information
>cd05707 S1_Rrp5_repeat_sc11 S1_Rrp5_repeat_sc11: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits Back     alignment and domain information
>PF04076 BOF: Bacterial OB fold (BOF) protein; InterPro: IPR005220 Proteins in this entry have an OB-fold fold (oligonucleotide/oligosaccharide binding motif) Back     alignment and domain information
>PF11948 DUF3465: Protein of unknown function (DUF3465); InterPro: IPR021856 This family of proteins are functionally uncharacterised Back     alignment and domain information
>PF12059 DUF3540: Protein of unknown function (DUF3540); InterPro: IPR021927 This family of proteins is functionally uncharacterised Back     alignment and domain information
>cd05698 S1_Rrp5_repeat_hs6_sc5 S1_Rrp5_repeat_hs6_sc5: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits Back     alignment and domain information
>TIGR00638 Mop molybdenum-pterin binding domain Back     alignment and domain information
>smart00316 S1 Ribosomal protein S1-like RNA-binding domain Back     alignment and domain information
>cd05697 S1_Rrp5_repeat_hs5 S1_Rrp5_repeat_hs5: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits Back     alignment and domain information
>PRK07252 hypothetical protein; Provisional Back     alignment and domain information
>cd05706 S1_Rrp5_repeat_sc10 S1_Rrp5_repeat_sc10: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits Back     alignment and domain information
>cd05691 S1_RPS1_repeat_ec6 S1_RPS1_repeat_ec6: Ribosomal protein S1 (RPS1) domain Back     alignment and domain information
>PF03459 TOBE: TOBE domain; InterPro: IPR005116 The TOBE domain [] (Transport-associated OB) always occurs as a dimer as the C-terminal strand of each domain is supplied by the partner Back     alignment and domain information
>TIGR00156 conserved hypothetical protein TIGR00156 Back     alignment and domain information
>PF07076 DUF1344: Protein of unknown function (DUF1344); InterPro: IPR009780 This family consists of several short, hypothetical bacterial proteins of around 80 residues in length Back     alignment and domain information
>cd04454 S1_Rrp4_like S1_Rrp4_like: Rrp4-like, S1-like RNA-binding domain Back     alignment and domain information
>COG1098 VacB Predicted RNA binding protein (contains ribosomal protein S1 domain) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK08582 hypothetical protein; Provisional Back     alignment and domain information
>cd05692 S1_RPS1_repeat_hs4 S1_RPS1_repeat_hs4: Ribosomal protein S1 (RPS1) domain Back     alignment and domain information
>cd05704 S1_Rrp5_repeat_hs13 S1_Rrp5_repeat_hs13: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits Back     alignment and domain information
>cd05789 S1_Rrp4 S1_Rrp4: Rrp4 S1-like RNA-binding domain Back     alignment and domain information
>cd05688 S1_RPS1_repeat_ec3 S1_RPS1_repeat_ec3: Ribosomal protein S1 (RPS1) domain Back     alignment and domain information
>PRK08059 general stress protein 13; Validated Back     alignment and domain information
>cd04461 S1_Rrp5_repeat_hs8_sc7 S1_Rrp5_repeat_hs8_sc7: Rrp5 Homo sapiens S1 repeat 8 (hs8) and Saccharomyces cerevisiae S1 repeat 7 (sc7)-like domains Back     alignment and domain information
>cd04452 S1_IF2_alpha S1_IF2_alpha: The alpha subunit of translation Initiation Factor 2, S1-like RNA-binding domain Back     alignment and domain information
>cd05696 S1_Rrp5_repeat_hs4 S1_Rrp5_repeat_hs4: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits Back     alignment and domain information
>cd05705 S1_Rrp5_repeat_hs14 S1_Rrp5_repeat_hs14: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits Back     alignment and domain information
>cd05690 S1_RPS1_repeat_ec5 S1_RPS1_repeat_ec5: Ribosomal protein S1 (RPS1) domain Back     alignment and domain information
>PRK03987 translation initiation factor IF-2 subunit alpha; Validated Back     alignment and domain information
>cd04471 S1_RNase_R S1_RNase_R: RNase R C-terminal S1 domain Back     alignment and domain information
>PRK10053 hypothetical protein; Provisional Back     alignment and domain information
>cd05703 S1_Rrp5_repeat_hs12_sc9 S1_Rrp5_repeat_hs12_sc9: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits Back     alignment and domain information
>PF00575 S1: S1 RNA binding domain; InterPro: IPR003029 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF04717 Phage_base_V: Phage-related baseplate assembly protein; InterPro: IPR006531 This domain occurs in a family of phage (and bacteriocin) proteins related to the phage P2 V gene product, which forms the small spike at the tip of the tail [] Back     alignment and domain information
>cd05687 S1_RPS1_repeat_ec1_hs1 S1_RPS1_repeat_ec1_hs1: Ribosomal protein S1 (RPS1) domain Back     alignment and domain information
>PHA02945 interferon resistance protein; Provisional Back     alignment and domain information
>cd04472 S1_PNPase S1_PNPase: Polynucleotide phosphorylase (PNPase), ), S1-like RNA-binding domain Back     alignment and domain information
>PF15057 DUF4537: Domain of unknown function (DUF4537) Back     alignment and domain information
>cd05708 S1_Rrp5_repeat_sc12 S1_Rrp5_repeat_sc12: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits Back     alignment and domain information
>cd04482 RPA2_OBF_like RPA2_OBF_like: A subgroup of uncharacterized archaeal OB folds with similarity to the OB fold of the central ssDNA-binding domain (DBD)-D of human RPA2 (also called RPA32) Back     alignment and domain information
>cd04455 S1_NusA S1_NusA: N-utilizing substance A protein (NusA), S1-like RNA-binding domain Back     alignment and domain information
>PF02736 Myosin_N: Myosin N-terminal SH3-like domain; InterPro: IPR004009 This domain has an SH3-like fold Back     alignment and domain information
>cd05695 S1_Rrp5_repeat_hs3 S1_Rrp5_repeat_hs3: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits Back     alignment and domain information
>cd05689 S1_RPS1_repeat_ec4 S1_RPS1_repeat_ec4: Ribosomal protein S1 (RPS1) domain Back     alignment and domain information
>cd05791 S1_CSL4 S1_CSL4: CSL4, S1-like RNA-binding domain Back     alignment and domain information
>PF00313 CSD: 'Cold-shock' DNA-binding domain; InterPro: IPR002059 When Escherichia coli is exposed to a temperature drop from 37 to 10 degrees centigrade, a 4-5 hour lag phase occurs, after which growth is resumed at a reduced rate [] Back     alignment and domain information
>PF12158 DUF3592: Protein of unknown function (DUF3592); InterPro: IPR021994 This family of proteins is functionally uncharacterised Back     alignment and domain information
>cd04487 RecJ_OBF2_like RecJ_OBF2_like: A subfamily of OB folds corresponding to the second OB fold (OBF2) of archaeal-specific proteins with similarity to eubacterial RecJ Back     alignment and domain information
>cd04453 S1_RNase_E S1_RNase_E: RNase E and RNase G, S1-like RNA-binding domain Back     alignment and domain information
>PRK07899 rpsA 30S ribosomal protein S1; Reviewed Back     alignment and domain information
>PTZ00248 eukaryotic translation initiation factor 2 subunit 1; Provisional Back     alignment and domain information
>cd05684 S1_DHX8_helicase S1_DHX8_helicase: The N-terminal S1 domain of human ATP-dependent RNA helicase DHX8, a DEAH (Asp-Glu-Ala-His) box polypeptide Back     alignment and domain information
>PRK13806 rpsA 30S ribosomal protein S1; Provisional Back     alignment and domain information
>cd04465 S1_RPS1_repeat_ec2_hs2 S1_RPS1_repeat_ec2_hs2: Ribosomal protein S1 (RPS1) domain Back     alignment and domain information
>cd05790 S1_Rrp40 S1_Rrp40: Rrp40 S1-like RNA-binding domain Back     alignment and domain information
>PRK05807 hypothetical protein; Provisional Back     alignment and domain information
>PRK13806 rpsA 30S ribosomal protein S1; Provisional Back     alignment and domain information
>cd04486 YhcR_OBF_like YhcR_OBF_like: A subfamily of OB-fold domains similar to the OB folds of Bacillus subtilis YhcR Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query140
1hr0_W71 Crystal Structure Of Initiation Factor If1 Bound To 1e-17
3i4o_A79 Crystal Structure Of Translation Initiation Factor 4e-16
1ah9_A71 The Structure Of The Translational Initiation Facto 1e-15
>pdb|1HR0|W Chain W, Crystal Structure Of Initiation Factor If1 Bound To The 30s Ribosomal Subunit Length = 71 Back     alignment and structure 
Iteration: 1

 Score = 84.7 bits (208), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 37/61 (60%), Positives = 50/61 (81%)
Query: 72  EGFITESLPNGMFRVRLDNEDLILGYISGKIRQNFIRVLPGDRVRVEVSRYDTSKGRIIY 131
           EG +TE+LPN  FRV+LD+   IL YISGK+R ++IR+LPGDRV VE++ YD ++GRI+Y
Sbjct: 10  EGVVTEALPNATFRVKLDSGPEILAYISGKMRMHYIRILPGDRVVVEITPYDPTRGRIVY 69
Query: 132 R 132
           R
Sbjct: 70  R 70
>pdb|3I4O|A Chain A, Crystal Structure Of Translation Initiation Factor 1 From Mycobacterium Tuberculosis Length = 79 Back     alignment and structure
>pdb|1AH9|A Chain A, The Structure Of The Translational Initiation Factor If1 From Escherichia Coli, Nmr, 19 Structures Length = 71 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query140
1ah9_A71 IF1, initiation factor 1; ribosome binding, protei 2e-35
3i4o_A79 Translation initiation factor IF-1; cytoplasm, pro 2e-35
1hr0_W71 Translation initiation factor; ribosomal subunit, 1e-33
1d7q_A143 Translation initiation factor 1A; OB-fold, beta-ba 2e-10
2oqk_A117 Putative translation initiation factor EIF-1A; mal 3e-10
2r7d_A469 Ribonuclease II family protein; structural genomic 5e-05
1jt8_A102 EIF-1A, probable translation initiation factor 1A; 1e-04
>1ah9_A IF1, initiation factor 1; ribosome binding, protein-RNA interaction, OB fold; NMR {Escherichia coli} SCOP: b.40.4.5 Length = 71 Back     alignment and structure
 Score =  116 bits (292), Expect = 2e-35
 Identities = 35/71 (49%), Positives = 52/71 (73%)

Query: 64  ANSEKWVHEGFITESLPNGMFRVRLDNEDLILGYISGKIRQNFIRVLPGDRVRVEVSRYD 123
           A  +    +G + E+LPN MFRV L+N  ++  +ISGK+R+N+IR+L GD+V VE++ YD
Sbjct: 1   AKEDNIEMQGTVLETLPNTMFRVELENGHVVTAHISGKMRKNYIRILTGDKVTVELTPYD 60

Query: 124 TSKGRIIYRLR 134
            SKGRI++R R
Sbjct: 61  LSKGRIVFRSR 71
>3i4o_A Translation initiation factor IF-1; cytoplasm, protein biosynthesis; 1.47A {Mycobacterium tuberculosis} Length = 79 Back     alignment and structure
>1hr0_W Translation initiation factor; ribosomal subunit, ribosome, IF1; 3.20A {Escherichia coli} SCOP: b.40.4.5 PDB: 1zo1_W Length = 71 Back     alignment and structure
>1d7q_A Translation initiation factor 1A; OB-fold, beta-barrel, RNA-binding protein, gene regulation; NMR {Homo sapiens} SCOP: b.40.4.5 Length = 143 Back     alignment and structure
>2oqk_A Putative translation initiation factor EIF-1A; malaria, eukaryotic initiation facto SGC, structural genomics; 1.80A {Cryptosporidium parvum iowa II} Length = 117 Back     alignment and structure
>2r7d_A Ribonuclease II family protein; structural genomics, PSI-2, structure initiative, northeast structural genomics consort NESG; 1.80A {Deinococcus radiodurans R1} SCOP: b.40.4.5 b.40.4.16 PDB: 2r7f_A Length = 469 Back     alignment and structure
>1jt8_A EIF-1A, probable translation initiation factor 1A; beta barrel, translation factor; NMR {Methanocaldococcus jannaschii} SCOP: b.40.4.5 Length = 102 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query140
3i4o_A79 Translation initiation factor IF-1; cytoplasm, pro 99.96
1jt8_A102 EIF-1A, probable translation initiation factor 1A; 99.93
1ah9_A71 IF1, initiation factor 1; ribosome binding, protei 99.92
1hr0_W71 Translation initiation factor; ribosomal subunit, 99.91
1d7q_A143 Translation initiation factor 1A; OB-fold, beta-ba 99.91
2dgy_A111 MGC11102 protein; EIF-1A, structural genomics, NPP 99.91
2oqk_A117 Putative translation initiation factor EIF-1A; mal 99.88
1t9h_A 307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 98.83
2yv5_A 302 YJEQ protein; hydrolase, GTPase, permutation, stru 98.52
2rcn_A 358 Probable GTPase ENGC; YJEQ, circularly permuted, G 98.51
2k52_A80 Uncharacterized protein MJ1198; metal-binding, zin 97.36
2khi_A115 30S ribosomal protein S1; acetylation, phosphoprot 97.22
1u0l_A 301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 96.19
2k4k_A130 GSP13, general stress protein 13; cytoplasm, stres 95.11
1luz_A88 Protein K3, protein K2; stranded anti-parallel bet 95.04
2khj_A109 30S ribosomal protein S1; OB fold, acetylation, ph 94.84
2wfw_A153 ARC; ATP-binding protein, proteasomal atpases, PAN 93.92
3h43_A85 Proteasome-activating nucleotidase; regulatory par 93.84
1kl9_A182 Eukaryotic translation initiation factor 2 subuni; 93.33
2eqs_A103 ATP-dependent RNA helicase DHX8; S1 domain, OB-fol 93.25
2wg5_A109 General control protein GCN4, proteasome-activatin 92.94
2a19_A175 EIF-2- alpha, eukaryotic translation initiation fa 92.65
2cqo_A119 Nucleolar protein of 40 kDa; S1 domain, OB-fold, s 91.85
3aev_A 275 Translation initiation factor 2 subunit alpha; pro 91.07
1nnx_A109 Protein YGIW; structural genomics, hypothetical pr 90.87
1wi5_A119 RRP5 protein homolog; S1 domain, OB-fold, structur 90.0
3m9b_A251 Proteasome-associated ATPase; coil COIL with 5 bet 88.46
1q8k_A 308 Eukaryotic translation initiation factor 2 subunit 86.28
2id0_A644 Exoribonuclease 2; RNAse, exonuclease, hydrolyase, 85.69
3cw2_C 266 Translation initiation factor 2 subunit alpha; AIF 82.42
3go5_A285 Multidomain protein with S1 RNA-binding domains; s 81.49
1gut_A68 Mopii, molybdate binding protein II; transport pro 80.61
3a0j_A73 Cold shock protein; OB-fold, cytoplasm, transcript 80.53
>3i4o_A Translation initiation factor IF-1; cytoplasm, protein biosynthesis; 1.47A {Mycobacterium tuberculosis} SCOP: b.40.4.5 Back     alignment and structure
Probab=99.96  E-value=1.8e-29  Score=177.25  Aligned_cols=70  Identities=51%  Similarity=0.870  Sum_probs=66.7

Q ss_pred             CCcceEEEEEEEEeCCCceEEEEeCCCCEEEEEecccccccccccCCCCEEEEEeccCCCCeEEEEEEec
Q 032460           65 NSEKWVHEGFITESLPNGMFRVRLDNEDLILGYISGKIRQNFIRVLPGDRVRVEVSRYDTSKGRIIYRLR  134 (140)
Q Consensus        65 k~d~ie~~GvVik~l~n~~f~V~l~dG~~~lcrI~GKmRk~~IrI~vGDrV~VE~sp~D~~kGrIiyRy~  134 (140)
                      ++|.++|+|+|++++||++|+|+|+||++++|+|+||||+++|||++||+|+||+||||++||+|+|||+
T Consensus        10 ~~~~ie~~G~Vik~l~n~~f~V~l~nG~~~~c~i~GK~Rk~~I~Il~GD~V~ve~~~yd~~kgrIi~R~~   79 (79)
T 3i4o_A           10 KDGAIEVEGRVVEPLPNAMFRIELENGHKVLAHISGKMRQHYIRILPEDRVVVELSPYDLSRGRIVYRYK   79 (79)
T ss_dssp             --CCSEEEEEEEEEETTTEEEEEETTSCEEEEEECHHHHHTTCCCCTTCEEEEEEETTEEEEEEEEEECC
T ss_pred             ccceEEEEEEEEEEcCCCEEEEEeCCCCEEEEEeCcceecCCccCCCCCEEEEEECccCCCcEEEEEEcC
Confidence            4578999999999999999999999999999999999999999999999999999999999999999985
>1jt8_A EIF-1A, probable translation initiation factor 1A; beta barrel, translation factor; NMR {Methanocaldococcus jannaschii} SCOP: b.40.4.5 Back     alignment and structure
>1ah9_A IF1, initiation factor 1; ribosome binding, protein-RNA interaction, OB fold; NMR {Escherichia coli} SCOP: b.40.4.5 Back     alignment and structure
>1hr0_W Translation initiation factor; ribosomal subunit, ribosome, IF1; 3.20A {Escherichia coli} SCOP: b.40.4.5 PDB: 1zo1_W Back     alignment and structure
>1d7q_A Translation initiation factor 1A; OB-fold, beta-barrel, RNA-binding protein, gene regulation; NMR {Homo sapiens} SCOP: b.40.4.5 Back     alignment and structure
>2dgy_A MGC11102 protein; EIF-1A, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2oqk_A Putative translation initiation factor EIF-1A; malaria, eukaryotic initiation facto SGC, structural genomics; 1.80A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>2k52_A Uncharacterized protein MJ1198; metal-binding, zinc, zinc-finger, structural genomics, PSI-2, protein structure initiative; NMR {Methanocaldococcus jannaschii} Back     alignment and structure
>2khi_A 30S ribosomal protein S1; acetylation, phosphoprotein, ribonucleoprotein, RNA-binding; NMR {Escherichia coli} Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>2k4k_A GSP13, general stress protein 13; cytoplasm, stress response, RNA binding protein; NMR {Bacillus subtilis} Back     alignment and structure
>1luz_A Protein K3, protein K2; stranded anti-parallel beta barrel, viral protein; 1.80A {Vaccinia virus} SCOP: b.40.4.5 Back     alignment and structure
>2khj_A 30S ribosomal protein S1; OB fold, acetylation, phosphoprotein, ribonucleoprotein, RNA-binding; NMR {Escherichia coli} Back     alignment and structure
>2wfw_A ARC; ATP-binding protein, proteasomal atpases, PAN, AAA, ATP-binding, nucleotide-binding; 1.60A {Rhodococcus erythropolis} PDB: 3fp9_A Back     alignment and structure
>3h43_A Proteasome-activating nucleotidase; regulatory particle, nucleosidase, ATP-binding, cytoplasm, nucleotide-binding, hydrolase; 2.10A {Methanocaldococcus jannaschii} Back     alignment and structure
>1kl9_A Eukaryotic translation initiation factor 2 subuni; OB fold, helical domain; 1.90A {Homo sapiens} SCOP: a.60.14.1 b.40.4.5 Back     alignment and structure
>2eqs_A ATP-dependent RNA helicase DHX8; S1 domain, OB-fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2wg5_A General control protein GCN4, proteasome-activating nucleotidase; transcription hydrolase complex, nucleotide-binding; 2.10A {Saccharomyces cerevisiae} PDB: 2wg6_A Back     alignment and structure
>2a19_A EIF-2- alpha, eukaryotic translation initiation factor 2 alpha; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Saccharomyces cerevisiae} PDB: 2a1a_A* 1q46_A Back     alignment and structure
>2cqo_A Nucleolar protein of 40 kDa; S1 domain, OB-fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3aev_A Translation initiation factor 2 subunit alpha; proteins-rRNA complex, 16S rRNA, RNA-binding; 2.80A {Pyrococcus horikoshii} PDB: 1yz6_A Back     alignment and structure
>1nnx_A Protein YGIW; structural genomics, hypothetical protein, OB-fold, structure 2 function project, S2F, unknown function; 1.45A {Escherichia coli} SCOP: b.40.10.1 Back     alignment and structure
>1wi5_A RRP5 protein homolog; S1 domain, OB-fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.40.4.5 Back     alignment and structure
>3m9b_A Proteasome-associated ATPase; coil COIL with 5 beta-strand barrel inter domain, chaperone; 3.94A {Mycobacterium tuberculosis} PDB: 3m9d_A Back     alignment and structure
>1q8k_A Eukaryotic translation initiation factor 2 subunit 1; NMR {Homo sapiens} SCOP: a.60.14.1 b.40.4.5 d.58.51.1 Back     alignment and structure
>2id0_A Exoribonuclease 2; RNAse, exonuclease, hydrolyase, mRNA decay, RNR family, hydrolase; 2.35A {Escherichia coli} SCOP: b.40.4.5 b.40.4.5 b.40.4.5 b.40.4.16 PDB: 2ix0_A* 2ix1_A Back     alignment and structure
>3cw2_C Translation initiation factor 2 subunit alpha; AIF2, intact AIF2, initiation factor 2 alpha subunit, initiation factor 2 beta subunit; 2.80A {Sulfolobus solfataricus} PDB: 2aho_B 3v11_B* Back     alignment and structure
>3go5_A Multidomain protein with S1 RNA-binding domains; structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.40A {Streptococcus pneumoniae} Back     alignment and structure
>1gut_A Mopii, molybdate binding protein II; transport protein; 1.50A {Clostridium pasteurianum} SCOP: b.40.6.1 PDB: 1gun_A 1guo_A 1gus_A 1gug_A Back     alignment and structure
>3a0j_A Cold shock protein; OB-fold, cytoplasm, transcription, structural genomics, NPPSFA; 1.65A {Thermus thermophilus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 140
d1hr0w_71 b.40.4.5 (W:) Translational initiation factor 1, I 4e-28
d1ah9a_71 b.40.4.5 (A:) Translational initiation factor 1, I 2e-25
d1d7qa_143 b.40.4.5 (A:) Translation initiation factor-1a, eI 2e-15
d1jt8a_102 b.40.4.5 (A:) Archaeal initiation factor-1a, aIF1a 3e-15
d1t9ha167 b.40.4.5 (A:1-67) Probable GTPase EngC (YjeQ), N-t 0.003
>d1hr0w_ b.40.4.5 (W:) Translational initiation factor 1, IF1 {Escherichia coli [TaxId: 562]} Length = 71 Back     information, alignment and structure

class: All beta proteins
fold: OB-fold
superfamily: Nucleic acid-binding proteins
family: Cold shock DNA-binding domain-like
domain: Translational initiation factor 1, IF1
species: Escherichia coli [TaxId: 562]

 Score = 96.6 bits (241), Expect = 4e-28
 Identities = 37/61 (60%), Positives = 50/61 (81%)

Query: 72  EGFITESLPNGMFRVRLDNEDLILGYISGKIRQNFIRVLPGDRVRVEVSRYDTSKGRIIY 131
           EG +TE+LPN  FRV+LD+   IL YISGK+R ++IR+LPGDRV VE++ YD ++GRI+Y
Sbjct: 10  EGVVTEALPNATFRVKLDSGPEILAYISGKMRMHYIRILPGDRVVVEITPYDPTRGRIVY 69

Query: 132 R 132
           R
Sbjct: 70  R 70
>d1ah9a_ b.40.4.5 (A:) Translational initiation factor 1, IF1 {Escherichia coli [TaxId: 562]} Length = 71 Back     information, alignment and structure
>d1d7qa_ b.40.4.5 (A:) Translation initiation factor-1a, eIF1a {Human (Homo sapiens) [TaxId: 9606]} Length = 143 Back     information, alignment and structure
>d1jt8a_ b.40.4.5 (A:) Archaeal initiation factor-1a, aIF1a {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 102 Back     information, alignment and structure
>d1t9ha1 b.40.4.5 (A:1-67) Probable GTPase EngC (YjeQ), N-terminal domain {Bacillus subtilis [TaxId: 1423]} Length = 67 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query140
d1ah9a_71 Translational initiation factor 1, IF1 {Escherichi 99.95
d1hr0w_71 Translational initiation factor 1, IF1 {Escherichi 99.93
d1jt8a_102 Archaeal initiation factor-1a, aIF1a {Archaeon Met 99.87
d1d7qa_143 Translation initiation factor-1a, eIF1a {Human (Ho 99.79
d1t9ha167 Probable GTPase EngC (YjeQ), N-terminal domain {Ba 99.57
d1u0la166 Probable GTPase EngC (YjeQ), N-terminal domain {Th 99.51
d1kl9a286 Eukaryotic initiation factor 2alpha, eIF2alpha, N- 93.56
d2je6i187 S1-domain of exosome complex RNA-binding protein 1 91.31
d2ahob284 Eukaryotic initiation factor 2alpha, eIF2alpha, N- 90.85
d1g291471 Maltose transport protein MalK, C-terminal domain 90.58
d2ba0a183 S1-domain of exosome complex RNA-binding protein 1 90.55
d2nn6g188 S1-domain of exosome component 3 (RRP40) {Human (H 89.98
d1nnxa_106 Hypothetical protein YgiW {Escherichia coli [TaxId 89.8
d1go3e1106 C-terminal domain of RNA polymerase II subunit RBP 88.84
d2ix0a279 Exoribonuclease 2, RNB {Escherichia coli [TaxId: 5 88.33
d3d31a1119 Sulfate/molybdate ABC transporter, ATP-binding pro 87.62
d3bzka494 Tex S1-domain {Pseudomonas aeruginosa [TaxId: 287] 87.34
d2z0sa188 S1-domain of exosome complex RNA-binding protein 1 83.7
d1v43a270 Hypothetical protein PH0022, C-terminal domain {Py 83.69
d1h9ra262 C-terminal domain of molybdate-dependent transcrip 82.96
d1guta_67 Molybdate/tungstate binding protein MOP {Clostridi 82.96
d1h9ma268 Cytoplasmic molybdate-binding protein ModG {Azotob 82.52
d1h9ra177 C-terminal domain of molybdate-dependent transcrip 81.78
d2ja9a190 S1-domain of exosome component 3 (RRP40) {Saccharo 81.76
d1h9ma173 Cytoplasmic molybdate-binding protein ModG {Azotob 80.08
>d1ah9a_ b.40.4.5 (A:) Translational initiation factor 1, IF1 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All beta proteins
fold: OB-fold
superfamily: Nucleic acid-binding proteins
family: Cold shock DNA-binding domain-like
domain: Translational initiation factor 1, IF1
species: Escherichia coli [TaxId: 562]

Probab=99.95  E-value=1.9e-29  Score=172.33  Aligned_cols=71  Identities=49%  Similarity=0.866  Sum_probs=68.8

Q ss_pred             cCCcceEEEEEEEEeCCCceEEEEeCCCCEEEEEecccccccccccCCCCEEEEEeccCCCCeEEEEEEec
Q 032460           64 ANSEKWVHEGFITESLPNGMFRVRLDNEDLILGYISGKIRQNFIRVLPGDRVRVEVSRYDTSKGRIIYRLR  134 (140)
Q Consensus        64 ~k~d~ie~~GvVik~l~n~~f~V~l~dG~~~lcrI~GKmRk~~IrI~vGDrV~VE~sp~D~~kGrIiyRy~  134 (140)
                      +|+|.++++|+|+++|||++|+|+|+||++++|+++||||+++|||.+||+|+||+||||+++|+|+|||+
T Consensus         1 aKed~ie~~G~V~e~lg~~~f~V~l~ng~~~~a~i~Gkmrk~ri~i~~GD~V~Vel~pyd~~kgrIi~R~k   71 (71)
T d1ah9a_           1 AKEDNIEMQGTVLETLPNTMFRVELENGHVVTAHISGKMRKNYIRILTGDKVTVELTPYDLSKGRIVFRSR   71 (71)
T ss_dssp             CCSCCEECCEEEEEECSSSEEEEEETTSCEEEEEECSSGGGTTCCCCTTCEECCEECSSCTTEEEECSCCC
T ss_pred             CCcccEEEEEEEEEEcCCCEEEEEeCCCCEEEEEccchhheeEEEecCCCEEEEEECccCCCcEEEEEEcC
Confidence            47889999999999999999999999999999999999999999999999999999999999999999985
>d1hr0w_ b.40.4.5 (W:) Translational initiation factor 1, IF1 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jt8a_ b.40.4.5 (A:) Archaeal initiation factor-1a, aIF1a {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1d7qa_ b.40.4.5 (A:) Translation initiation factor-1a, eIF1a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t9ha1 b.40.4.5 (A:1-67) Probable GTPase EngC (YjeQ), N-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1u0la1 b.40.4.5 (A:3-68) Probable GTPase EngC (YjeQ), N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1kl9a2 b.40.4.5 (A:3-88) Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2je6i1 b.40.4.5 (I:66-152) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2ahob2 b.40.4.5 (B:1-84) Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1g2914 b.40.6.3 (1:302-372) Maltose transport protein MalK, C-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d2ba0a1 b.40.4.5 (A:53-135) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2nn6g1 b.40.4.5 (G:107-194) S1-domain of exosome component 3 (RRP40) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nnxa_ b.40.10.1 (A:) Hypothetical protein YgiW {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1go3e1 b.40.4.5 (E:79-184) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2ix0a2 b.40.4.5 (A:4-82) Exoribonuclease 2, RNB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3d31a1 b.40.6.3 (A:230-348) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d3bzka4 b.40.4.5 (A:637-730) Tex S1-domain {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2z0sa1 b.40.4.5 (A:60-147) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1v43a2 b.40.6.3 (A:304-373) Hypothetical protein PH0022, C-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1h9ra2 b.40.6.2 (A:200-261) C-terminal domain of molybdate-dependent transcriptional regulator ModE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1guta_ b.40.6.1 (A:) Molybdate/tungstate binding protein MOP {Clostridium pasteurianum, MOP II [TaxId: 1501]} Back     information, alignment and structure
>d1h9ma2 b.40.6.2 (A:74-141) Cytoplasmic molybdate-binding protein ModG {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1h9ra1 b.40.6.2 (A:123-199) C-terminal domain of molybdate-dependent transcriptional regulator ModE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ja9a1 b.40.4.5 (A:62-151) S1-domain of exosome component 3 (RRP40) {Saccharomyces cerevisiae [TaxId: 4932]} Back     information, alignment and structure
>d1h9ma1 b.40.6.2 (A:1-73) Cytoplasmic molybdate-binding protein ModG {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure