Citrus Sinensis ID: 032467
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 140 | ||||||
| 255565455 | 275 | zinc finger protein, putative [Ricinus c | 0.992 | 0.505 | 0.820 | 1e-66 | |
| 224106846 | 291 | predicted protein [Populus trichocarpa] | 0.971 | 0.467 | 0.808 | 1e-63 | |
| 225436458 | 289 | PREDICTED: RING finger and CHY zinc fing | 0.992 | 0.480 | 0.755 | 5e-60 | |
| 147767897 | 211 | hypothetical protein VITISV_009522 [Viti | 0.985 | 0.654 | 0.753 | 9e-60 | |
| 388513121 | 299 | unknown [Lotus japonicus] | 0.992 | 0.464 | 0.726 | 7e-58 | |
| 225441157 | 289 | PREDICTED: RING finger and CHY zinc fing | 0.985 | 0.477 | 0.705 | 1e-55 | |
| 356539356 | 298 | PREDICTED: RING finger and CHY zinc fing | 0.992 | 0.466 | 0.705 | 3e-55 | |
| 255645984 | 298 | unknown [Glycine max] | 0.992 | 0.466 | 0.705 | 3e-55 | |
| 15237169 | 291 | ring finger and CHY zinc finger domain-c | 1.0 | 0.481 | 0.687 | 4e-55 | |
| 297808281 | 291 | zinc finger family protein [Arabidopsis | 1.0 | 0.481 | 0.680 | 8e-55 |
| >gi|255565455|ref|XP_002523718.1| zinc finger protein, putative [Ricinus communis] gi|223537022|gb|EEF38658.1| zinc finger protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 257 bits (656), Expect = 1e-66, Method: Compositional matrix adjust.
Identities = 114/139 (82%), Positives = 131/139 (94%)
Query: 1 MKDKHRCVERAMHHNCPICFEFIFDTMKDITVLRCGHTIHLECLKEMEKHYRYTCPVCSK 60
MKD HRCVERAMHHNCP+CFEF+FDTMKDITVL CGHTIHLEC++EME+HYRY+CPVCSK
Sbjct: 136 MKDAHRCVERAMHHNCPVCFEFLFDTMKDITVLPCGHTIHLECVREMEQHYRYSCPVCSK 195
Query: 61 SLWDMSKLWSKIDQEIASTPMPAMYQNKMVWILCNDCGANSHVQFHVIAHKCLSCKSYNT 120
S+ DMSKLW K+DQEIA+TPMP +YQNKMVWILCNDCGANSHVQFH++AHKCL+CKSYNT
Sbjct: 196 SICDMSKLWRKLDQEIAATPMPEIYQNKMVWILCNDCGANSHVQFHIVAHKCLNCKSYNT 255
Query: 121 RQTRGDTATTCSSGVAEIV 139
RQTRGD+ +CSS +AE+V
Sbjct: 256 RQTRGDSTASCSSEMAEMV 274
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224106846|ref|XP_002314304.1| predicted protein [Populus trichocarpa] gi|222850712|gb|EEE88259.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|225436458|ref|XP_002274709.1| PREDICTED: RING finger and CHY zinc finger domain-containing protein 1 [Vitis vinifera] gi|297734901|emb|CBI17135.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|147767897|emb|CAN64539.1| hypothetical protein VITISV_009522 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|388513121|gb|AFK44622.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
| >gi|225441157|ref|XP_002268193.1| PREDICTED: RING finger and CHY zinc finger domain-containing protein 1 isoform 2 [Vitis vinifera] gi|225441159|ref|XP_002268149.1| PREDICTED: RING finger and CHY zinc finger domain-containing protein 1 isoform 1 [Vitis vinifera] gi|297739980|emb|CBI30162.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356539356|ref|XP_003538164.1| PREDICTED: RING finger and CHY zinc finger domain-containing protein 1-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|255645984|gb|ACU23480.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|15237169|ref|NP_197683.1| ring finger and CHY zinc finger domain-containing protein 1 [Arabidopsis thaliana] gi|10177239|dbj|BAB10613.1| PGPD14 protein [Arabidopsis thaliana] gi|15450521|gb|AAK96553.1| AT5g22920/MRN17_15 [Arabidopsis thaliana] gi|27363264|gb|AAO11551.1| At5g22920/MRN17_15 [Arabidopsis thaliana] gi|66865966|gb|AAY57617.1| RING finger family protein [Arabidopsis thaliana] gi|332005714|gb|AED93097.1| ring finger and CHY zinc finger domain-containing protein 1 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297808281|ref|XP_002872024.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] gi|297317861|gb|EFH48283.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 140 | ||||||
| TAIR|locus:2172656 | 291 | AT5G22920 [Arabidopsis thalian | 0.992 | 0.477 | 0.692 | 4.6e-57 | |
| TAIR|locus:2180074 | 267 | MIEL1 "MYB30-Interacting E3 Li | 0.864 | 0.453 | 0.537 | 3.3e-40 | |
| TAIR|locus:2099212 | 287 | AT3G62970 [Arabidopsis thalian | 0.864 | 0.421 | 0.459 | 3.2e-33 | |
| TAIR|locus:2179474 | 328 | AT5G25560 [Arabidopsis thalian | 0.642 | 0.274 | 0.655 | 5.2e-33 | |
| UNIPROTKB|F1P5N8 | 190 | RCHY1 "Uncharacterized protein | 0.864 | 0.636 | 0.483 | 2.6e-31 | |
| ZFIN|ZDB-GENE-040801-73 | 264 | rchy1 "ring finger and CHY zin | 0.95 | 0.503 | 0.458 | 8.8e-31 | |
| RGD|1359180 | 261 | Rchy1 "ring finger and CHY zin | 0.914 | 0.490 | 0.472 | 1.1e-30 | |
| UNIPROTKB|F1RYV2 | 232 | RCHY1 "Uncharacterized protein | 0.885 | 0.534 | 0.48 | 1.4e-30 | |
| UNIPROTKB|E7ETW5 | 239 | RCHY1 "RING finger and CHY zin | 0.885 | 0.518 | 0.472 | 1.8e-30 | |
| UNIPROTKB|J3KPI0 | 221 | RCHY1 "RING finger and CHY zin | 0.885 | 0.561 | 0.472 | 1.8e-30 |
| TAIR|locus:2172656 AT5G22920 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 587 (211.7 bits), Expect = 4.6e-57, P = 4.6e-57
Identities = 97/140 (69%), Positives = 122/140 (87%)
Query: 1 MKDKHRCVERAMHHNCPICFEFIFDTMKDITVLRCGHTIHLECLKEMEKHYRYTCPVCSK 60
M+DKH+CVE AMHHNCP+CFE++FD+ +DITVLRCGHT+HLEC K+M H RYTCPVCSK
Sbjct: 148 MEDKHQCVEGAMHHNCPVCFEYLFDSTRDITVLRCGHTMHLECTKDMGLHNRYTCPVCSK 207
Query: 61 SLWDMSKLWSKIDQEIASTPMPAMYQNKMVWILCNDCGANSHVQFHVIAHKCLSCKSYNT 120
S+ DMS LW K+D+E+A+ PMP MY+NKMVWILCNDCG+N++V+FH+IAHKC SC SYNT
Sbjct: 208 SICDMSNLWKKLDEEVAAYPMPKMYENKMVWILCNDCGSNTNVRFHLIAHKCSSCGSYNT 267
Query: 121 RQT-RGDTATTCSSGVAEIV 139
RQT RG + +CSSG+ ++V
Sbjct: 268 RQTQRGSDSHSCSSGMPQVV 287
|
|
| TAIR|locus:2180074 MIEL1 "MYB30-Interacting E3 Ligase 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2099212 AT3G62970 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2179474 AT5G25560 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1P5N8 RCHY1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040801-73 rchy1 "ring finger and CHY zinc finger domain containing 1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| RGD|1359180 Rchy1 "ring finger and CHY zinc finger domain containing 1, E3 ubiquitin protein ligase" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RYV2 RCHY1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E7ETW5 RCHY1 "RING finger and CHY zinc finger domain-containing protein 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J3KPI0 RCHY1 "RING finger and CHY zinc finger domain-containing protein 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 140 | |||
| cd00162 | 45 | cd00162, RING, RING-finger (Really Interesting New | 3e-05 | |
| pfam13639 | 46 | pfam13639, zf-RING_2, Ring finger domain | 4e-05 | |
| COG5243 | 491 | COG5243, HRD1, HRD ubiquitin ligase complex, ER me | 8e-05 | |
| smart00184 | 40 | smart00184, RING, Ring finger | 3e-04 | |
| COG5540 | 374 | COG5540, COG5540, RING-finger-containing ubiquitin | 0.004 |
| >gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
Score = 39.0 bits (91), Expect = 3e-05
Identities = 15/47 (31%), Positives = 23/47 (48%), Gaps = 3/47 (6%)
Query: 16 CPICFEFIFDTMKDITVLRCGHTIHLECLKEMEKHYRYTCPVCSKSL 62
CPIC E + + +L CGH C+ + K + TCP+C +
Sbjct: 2 CPICLEEFRE---PVVLLPCGHVFCRSCIDKWLKSGKNTCPLCRTPI 45
|
Length = 45 |
| >gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain | Back alignment and domain information |
|---|
| >gnl|CDD|227568 COG5243, HRD1, HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|214546 smart00184, RING, Ring finger | Back alignment and domain information |
|---|
| >gnl|CDD|227827 COG5540, COG5540, RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 140 | |||
| KOG1940 | 276 | consensus Zn-finger protein [General function pred | 99.89 | |
| PF14599 | 61 | zinc_ribbon_6: Zinc-ribbon; PDB: 2K2D_A. | 99.75 | |
| PF13639 | 44 | zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C | 99.47 | |
| PF15227 | 42 | zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: | 99.34 | |
| PLN03208 | 193 | E3 ubiquitin-protein ligase RMA2; Provisional | 99.23 | |
| PF12678 | 73 | zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 | 99.22 | |
| PF13920 | 50 | zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); | 99.22 | |
| PF13923 | 39 | zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); | 99.21 | |
| PHA02929 | 238 | N1R/p28-like protein; Provisional | 99.2 | |
| PF13445 | 43 | zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. | 99.18 | |
| cd00162 | 45 | RING RING-finger (Really Interesting New Gene) dom | 99.16 | |
| PF14634 | 44 | zf-RING_5: zinc-RING finger domain | 99.15 | |
| PF00097 | 41 | zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I | 99.1 | |
| KOG4628 | 348 | consensus Predicted E3 ubiquitin ligase [Posttrans | 99.1 | |
| COG5243 | 491 | HRD1 HRD ubiquitin ligase complex, ER membrane com | 99.09 | |
| KOG0320 | 187 | consensus Predicted E3 ubiquitin ligase [Posttrans | 99.06 | |
| PHA02926 | 242 | zinc finger-like protein; Provisional | 99.03 | |
| KOG0823 | 230 | consensus Predicted E3 ubiquitin ligase [Posttrans | 99.02 | |
| smart00184 | 39 | RING Ring finger. E3 ubiquitin-protein ligase acti | 98.98 | |
| KOG0804 | 493 | consensus Cytoplasmic Zn-finger protein BRAP2 (BRC | 98.98 | |
| smart00504 | 63 | Ubox Modified RING finger domain. Modified RING fi | 98.92 | |
| KOG0317 | 293 | consensus Predicted E3 ubiquitin ligase, integral | 98.91 | |
| PF12861 | 85 | zf-Apc11: Anaphase-promoting complex subunit 11 RI | 98.82 | |
| COG5540 | 374 | RING-finger-containing ubiquitin ligase [Posttrans | 98.8 | |
| TIGR00599 | 397 | rad18 DNA repair protein rad18. This family is bas | 98.69 | |
| KOG2164 | 513 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.64 | |
| KOG0287 | 442 | consensus Postreplication repair protein RAD18 [Re | 98.61 | |
| KOG2177 | 386 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.55 | |
| KOG0802 | 543 | consensus E3 ubiquitin ligase [Posttranslational m | 98.55 | |
| TIGR00570 | 309 | cdk7 CDK-activating kinase assembly factor MAT1. A | 98.54 | |
| COG5574 | 271 | PEX10 RING-finger-containing E3 ubiquitin ligase [ | 98.52 | |
| PF04564 | 73 | U-box: U-box domain; InterPro: IPR003613 Quality c | 98.5 | |
| COG5194 | 88 | APC11 Component of SCF ubiquitin ligase and anapha | 98.32 | |
| PF11793 | 70 | FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. | 98.31 | |
| KOG1039 | 344 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.27 | |
| COG5432 | 391 | RAD18 RING-finger-containing E3 ubiquitin ligase [ | 98.22 | |
| smart00744 | 49 | RINGv The RING-variant domain is a C4HC3 zinc-fing | 98.19 | |
| KOG4172 | 62 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.16 | |
| PF14835 | 65 | zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM | 98.13 | |
| KOG0824 | 324 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.09 | |
| KOG0828 | 636 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.0 | |
| KOG0827 | 465 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.96 | |
| KOG4265 | 349 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.92 | |
| KOG0978 | 698 | consensus E3 ubiquitin ligase involved in syntaxin | 97.9 | |
| KOG0311 | 381 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.89 | |
| PF14570 | 48 | zf-RING_4: RING/Ubox like zinc-binding domain; PDB | 97.87 | |
| KOG1493 | 84 | consensus Anaphase-promoting complex (APC), subuni | 97.86 | |
| KOG1734 | 328 | consensus Predicted RING-containing E3 ubiquitin l | 97.8 | |
| KOG4159 | 398 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.74 | |
| KOG2930 | 114 | consensus SCF ubiquitin ligase, Rbx1 component [Po | 97.54 | |
| KOG2879 | 298 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.53 | |
| KOG4185 | 296 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.49 | |
| PF11789 | 57 | zf-Nse: Zinc-finger of the MIZ type in Nse subunit | 97.48 | |
| KOG1785 | 563 | consensus Tyrosine kinase negative regulator CBL [ | 97.44 | |
| COG5219 | 1525 | Uncharacterized conserved protein, contains RING Z | 97.42 | |
| KOG1645 | 463 | consensus RING-finger-containing E3 ubiquitin liga | 97.37 | |
| KOG0825 | 1134 | consensus PHD Zn-finger protein [General function | 97.36 | |
| KOG1941 | 518 | consensus Acetylcholine receptor-associated protei | 97.19 | |
| COG5175 | 480 | MOT2 Transcriptional repressor [Transcription] | 97.09 | |
| KOG1814 | 445 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.08 | |
| KOG4275 | 350 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.08 | |
| COG5152 | 259 | Uncharacterized conserved protein, contains RING a | 97.05 | |
| KOG3970 | 299 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.0 | |
| KOG0297 | 391 | consensus TNF receptor-associated factor [Signal t | 96.91 | |
| KOG1813 | 313 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.85 | |
| KOG2660 | 331 | consensus Locus-specific chromosome binding protei | 96.8 | |
| PF12906 | 47 | RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A. | 96.68 | |
| PF14447 | 55 | Prok-RING_4: Prokaryotic RING finger family 4 | 96.57 | |
| KOG1002 | 791 | consensus Nucleotide excision repair protein RAD16 | 96.56 | |
| KOG3039 | 303 | consensus Uncharacterized conserved protein [Funct | 96.45 | |
| KOG4692 | 489 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.43 | |
| KOG1952 | 950 | consensus Transcription factor NF-X1, contains NFX | 96.42 | |
| KOG3800 | 300 | consensus Predicted E3 ubiquitin ligase containing | 96.42 | |
| PF04641 | 260 | Rtf2: Rtf2 RING-finger | 96.4 | |
| PF10367 | 109 | Vps39_2: Vacuolar sorting protein 39 domain 2; Int | 96.35 | |
| KOG4445 | 368 | consensus Uncharacterized conserved protein, conta | 96.34 | |
| KOG1571 | 355 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.19 | |
| KOG1428 | 3738 | consensus Inhibitor of type V adenylyl cyclases/Ne | 96.02 | |
| PF05883 | 134 | Baculo_RING: Baculovirus U-box/Ring-like domain; I | 95.9 | |
| KOG4739 | 233 | consensus Uncharacterized protein involved in syna | 95.82 | |
| PHA02862 | 156 | 5L protein; Provisional | 95.65 | |
| COG5222 | 427 | Uncharacterized conserved protein, contains RING Z | 95.63 | |
| KOG2817 | 394 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.61 | |
| KOG3161 | 861 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.61 | |
| PHA02825 | 162 | LAP/PHD finger-like protein; Provisional | 95.46 | |
| PHA03096 | 284 | p28-like protein; Provisional | 95.46 | |
| PF03854 | 50 | zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc | 95.31 | |
| PF07800 | 162 | DUF1644: Protein of unknown function (DUF1644); In | 95.13 | |
| COG5236 | 493 | Uncharacterized conserved protein, contains RING Z | 95.09 | |
| KOG3002 | 299 | consensus Zn finger protein [General function pred | 94.69 | |
| COG5220 | 314 | TFB3 Cdk activating kinase (CAK)/RNA polymerase II | 94.27 | |
| KOG2114 | 933 | consensus Vacuolar assembly/sorting protein PEP5/V | 94.23 | |
| KOG1001 | 674 | consensus Helicase-like transcription factor HLTF/ | 94.17 | |
| KOG3268 | 234 | consensus Predicted E3 ubiquitin ligase [Posttrans | 94.01 | |
| KOG4367 | 699 | consensus Predicted Zn-finger protein [Function un | 93.9 | |
| PF02891 | 50 | zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR0041 | 93.33 | |
| KOG2932 | 389 | consensus E3 ubiquitin ligase involved in ubiquiti | 92.77 | |
| PF10272 | 358 | Tmpp129: Putative transmembrane protein precursor; | 92.57 | |
| KOG1812 | 384 | consensus Predicted E3 ubiquitin ligase [Posttrans | 92.28 | |
| PF05290 | 140 | Baculo_IE-1: Baculovirus immediate-early protein ( | 92.26 | |
| KOG0827 | 465 | consensus Predicted E3 ubiquitin ligase [Posttrans | 90.08 | |
| KOG2068 | 327 | consensus MOT2 transcription factor [Transcription | 89.34 | |
| KOG2034 | 911 | consensus Vacuolar sorting protein PEP3/VPS18 [Int | 89.33 | |
| PF08746 | 43 | zf-RING-like: RING-like domain; InterPro: IPR01485 | 88.94 | |
| KOG0826 | 357 | consensus Predicted E3 ubiquitin ligase involved i | 88.44 | |
| PF07191 | 70 | zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 | 88.27 | |
| KOG0298 | 1394 | consensus DEAD box-containing helicase-like transc | 87.62 | |
| TIGR00100 | 115 | hypA hydrogenase nickel insertion protein HypA. In | 87.03 | |
| PF14569 | 80 | zf-UDP: Zinc-binding RING-finger; PDB: 1WEO_A. | 86.84 | |
| COG5109 | 396 | Uncharacterized conserved protein, contains RING Z | 86.54 | |
| PF14446 | 54 | Prok-RING_1: Prokaryotic RING finger family 1 | 86.53 | |
| KOG0309 | 1081 | consensus Conserved WD40 repeat-containing protein | 86.07 | |
| KOG1100 | 207 | consensus Predicted E3 ubiquitin ligase [Posttrans | 85.89 | |
| PRK12380 | 113 | hydrogenase nickel incorporation protein HybF; Pro | 85.15 | |
| KOG1815 | 444 | consensus Predicted E3 ubiquitin ligase [Posttrans | 84.63 | |
| KOG4185 | 296 | consensus Predicted E3 ubiquitin ligase [Posttrans | 83.51 | |
| PRK00564 | 117 | hypA hydrogenase nickel incorporation protein; Pro | 82.82 | |
| PRK03681 | 114 | hypA hydrogenase nickel incorporation protein; Val | 81.59 | |
| PF01155 | 113 | HypA: Hydrogenase expression/synthesis hypA family | 80.72 | |
| COG5183 | 1175 | SSM4 Protein involved in mRNA turnover and stabili | 80.26 |
| >KOG1940 consensus Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
Probab=99.89 E-value=2.5e-23 Score=162.59 Aligned_cols=124 Identities=48% Similarity=0.979 Sum_probs=117.7
Q ss_pred CCCccccccCcccccccccccccccCCccEEecCCCcccHHHHHhhhccccCCCCCCCCCCchhhhHHHHHHHHHhcCCC
Q 032467 2 KDKHRCVERAMHHNCPICFEFIFDTMKDITVLRCGHTIHLECLKEMEKHYRYTCPVCSKSLWDMSKLWSKIDQEIASTPM 81 (140)
Q Consensus 2 ~~~h~c~e~~~~~~C~IC~e~l~~~~~~~~~l~CgH~Fc~~Cl~~~~~~~~~~CP~CR~~~~~~~~~~~~l~~~~~~~~~ 81 (140)
.++|.|+|++.+..||||.|.++.+...+..++|||..|.+|++.....+ ++||+|.+ +.+++.+|+.++.++...++
T Consensus 147 ~~~H~c~e~~~~~ncPic~e~l~~s~~~~~~~~CgH~~h~~cf~e~~~~~-y~CP~C~~-~~d~~~~~~~~d~~l~~~~~ 224 (276)
T KOG1940|consen 147 SNWHKCVERSSEFNCPICKEYLFLSFEDAGVLKCGHYMHSRCFEEMICEG-YTCPICSK-PGDMSHYFRKLDKELAGSPM 224 (276)
T ss_pred ccccchhhhcccCCCchhHHHhccccccCCccCcccchHHHHHHHHhccC-CCCCcccc-hHHHHHHHHHHHHHHhcCCC
Confidence 46799999999999999999999999999999999999999999998756 99999999 99999999999999999999
Q ss_pred ChhhhcccceecCCCCCCCcccceeeeccccccCCCcccccccCCC
Q 032467 82 PAMYQNKMVWILCNDCGANSHVQFHVIAHKCLSCKSYNTRQTRGDT 127 (140)
Q Consensus 82 ~~~~~~~~~~i~C~~C~~~~~~~~~~~~~~C~~C~~~~~~~~~~~~ 127 (140)
|++|+++..++.|++|+...+++||+++++|+.|++||+++++.|.
T Consensus 225 p~~y~~~~~~i~cndC~~~~~~k~~~l~~kc~~c~~~~~r~~~~~~ 270 (276)
T KOG1940|consen 225 PEEYKNKTQDILCNDCGSGTNVKYHILYHKCGKCGSYNTRMISDPS 270 (276)
T ss_pred CchhhchhheeeccCCCCCCccceehhhhhCCCcccceeeeccCCC
Confidence 9999999999999999999999999999999999999999998443
|
|
| >PF14599 zinc_ribbon_6: Zinc-ribbon; PDB: 2K2D_A | Back alignment and domain information |
|---|
| >PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A | Back alignment and domain information |
|---|
| >PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A | Back alignment and domain information |
|---|
| >PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional | Back alignment and domain information |
|---|
| >PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A | Back alignment and domain information |
|---|
| >PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A | Back alignment and domain information |
|---|
| >PHA02929 N1R/p28-like protein; Provisional | Back alignment and domain information |
|---|
| >PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A | Back alignment and domain information |
|---|
| >cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >PF14634 zf-RING_5: zinc-RING finger domain | Back alignment and domain information |
|---|
| >PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA02926 zinc finger-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00184 RING Ring finger | Back alignment and domain information |
|---|
| >KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] | Back alignment and domain information |
|---|
| >smart00504 Ubox Modified RING finger domain | Back alignment and domain information |
|---|
| >KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger | Back alignment and domain information |
|---|
| >COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00599 rad18 DNA repair protein rad18 | Back alignment and domain information |
|---|
| >KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 | Back alignment and domain information |
|---|
| >COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis | Back alignment and domain information |
|---|
| >COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A | Back alignment and domain information |
|---|
| >KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins | Back alignment and domain information |
|---|
| >KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B | Back alignment and domain information |
|---|
| >KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B | Back alignment and domain information |
|---|
| >KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C | Back alignment and domain information |
|---|
| >KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] | Back alignment and domain information |
|---|
| >COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0825 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] | Back alignment and domain information |
|---|
| >COG5175 MOT2 Transcriptional repressor [Transcription] | Back alignment and domain information |
|---|
| >KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] | Back alignment and domain information |
|---|
| >PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A | Back alignment and domain information |
|---|
| >PF14447 Prok-RING_4: Prokaryotic RING finger family 4 | Back alignment and domain information |
|---|
| >KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG3039 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1952 consensus Transcription factor NF-X1, contains NFX-type Zn2+-binding and R3H domains [Transcription] | Back alignment and domain information |
|---|
| >KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF04641 Rtf2: Rtf2 RING-finger | Back alignment and domain information |
|---|
| >PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 | Back alignment and domain information |
|---|
| >KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] | Back alignment and domain information |
|---|
| >KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length | Back alignment and domain information |
|---|
| >KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >PHA02862 5L protein; Provisional | Back alignment and domain information |
|---|
| >COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3161 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA02825 LAP/PHD finger-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA03096 p28-like protein; Provisional | Back alignment and domain information |
|---|
| >PF03854 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function | Back alignment and domain information |
|---|
| >COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3002 consensus Zn finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG3268 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4367 consensus Predicted Zn-finger protein [Function unknown] | Back alignment and domain information |
|---|
| >PF02891 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans | Back alignment and domain information |
|---|
| >KOG1812 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 | Back alignment and domain information |
|---|
| >KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2068 consensus MOT2 transcription factor [Transcription] | Back alignment and domain information |
|---|
| >KOG2034 consensus Vacuolar sorting protein PEP3/VPS18 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) | Back alignment and domain information |
|---|
| >KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF07191 zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 This family consists of several short, hypothetical bacterial proteins of around 70 residues in length | Back alignment and domain information |
|---|
| >KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR00100 hypA hydrogenase nickel insertion protein HypA | Back alignment and domain information |
|---|
| >PF14569 zf-UDP: Zinc-binding RING-finger; PDB: 1WEO_A | Back alignment and domain information |
|---|
| >COG5109 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >PF14446 Prok-RING_1: Prokaryotic RING finger family 1 | Back alignment and domain information |
|---|
| >KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1100 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK12380 hydrogenase nickel incorporation protein HybF; Provisional | Back alignment and domain information |
|---|
| >KOG1815 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK00564 hypA hydrogenase nickel incorporation protein; Provisional | Back alignment and domain information |
|---|
| >PRK03681 hypA hydrogenase nickel incorporation protein; Validated | Back alignment and domain information |
|---|
| >PF01155 HypA: Hydrogenase expression/synthesis hypA family; InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation | Back alignment and domain information |
|---|
| >COG5183 SSM4 Protein involved in mRNA turnover and stability [RNA processing and modification] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 140 | ||||
| 2k2d_A | 79 | Solution Nmr Structure Of C-Terminal Domain Of Huma | 2e-16 | ||
| 2jrj_A | 52 | Solution Structure Of The Human Pirh2 Ring-H2 Domai | 2e-04 | ||
| 2ecm_A | 55 | Solution Structure Of The Ring Domain Of The Ring F | 3e-04 |
| >pdb|2K2D|A Chain A, Solution Nmr Structure Of C-Terminal Domain Of Human Pirh2. Northeast Structural Genomics Consortium (Nesg) Target Ht2c Length = 79 | Back alignment and structure |
|
| >pdb|2JRJ|A Chain A, Solution Structure Of The Human Pirh2 Ring-H2 Domain. Northeast Structural Genomics Consortium Target Ht2b Length = 52 | Back alignment and structure |
| >pdb|2ECM|A Chain A, Solution Structure Of The Ring Domain Of The Ring Finger And Chy Zinc Finger Domain-Containing Protein 1 From Mus Musculus Length = 55 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 140 | |||
| 2k2d_A | 79 | Ring finger and CHY zinc finger domain- containing | 1e-32 | |
| 2ecm_A | 55 | Ring finger and CHY zinc finger domain- containing | 2e-15 | |
| 2y1n_A | 389 | E3 ubiquitin-protein ligase; ligase-transferase co | 8e-08 | |
| 1e4u_A | 78 | Transcriptional repressor NOT4; gene regulation, t | 5e-06 | |
| 3ng2_A | 71 | RNF4, snurf, ring finger protein 4; ring domain, E | 7e-06 | |
| 3fl2_A | 124 | E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA | 1e-05 | |
| 2ea6_A | 69 | Ring finger protein 4; RNF4, RES4-26, ring domain, | 1e-05 | |
| 2xeu_A | 64 | Ring finger protein 4; transcription, zinc-finger, | 2e-05 | |
| 2ct2_A | 88 | Tripartite motif protein 32; zinc-finger protein H | 5e-05 | |
| 2ckl_B | 165 | Ubiquitin ligase protein RING2; BMI1, RING1B, poly | 8e-05 | |
| 1z6u_A | 150 | NP95-like ring finger protein isoform B; structura | 1e-04 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 2e-04 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 4e-04 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 5e-04 | |
| 3l11_A | 115 | E3 ubiquitin-protein ligase RNF168; E3 ligase, rin | 6e-04 |
| >2k2d_A Ring finger and CHY zinc finger domain- containing protein 1; zinc-binding protein, cytoplasm, metal-binding, nucleus, metal binding protein; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
Score = 109 bits (273), Expect = 1e-32
Identities = 35/68 (51%), Positives = 44/68 (64%)
Query: 58 CSKSLWDMSKLWSKIDQEIASTPMPAMYQNKMVWILCNDCGANSHVQFHVIAHKCLSCKS 117
S DM++ W ++D E+A TPMP+ YQN V ILCNDC S VQFH++ KC C+S
Sbjct: 4 MMHSALDMTRYWRQLDDEVAQTPMPSEYQNMTVDILCNDCNGRSTVQFHILGMKCKICES 63
Query: 118 YNTRQTRG 125
YNT Q G
Sbjct: 64 YNTAQAGG 71
|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55 | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 | Back alignment and structure |
|---|
| >1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Length = 78 | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Length = 165 | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150 | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 140 | |||
| 2k2d_A | 79 | Ring finger and CHY zinc finger domain- containing | 99.82 | |
| 2ecm_A | 55 | Ring finger and CHY zinc finger domain- containing | 99.56 | |
| 2kiz_A | 69 | E3 ubiquitin-protein ligase arkadia; ring-H2 finge | 99.48 | |
| 1g25_A | 65 | CDK-activating kinase assembly factor MAT1; ring f | 99.48 | |
| 2ep4_A | 74 | Ring finger protein 24; zinc binding, ubiquitin, E | 99.48 | |
| 1iym_A | 55 | EL5; ring-H2 finger, ubiquitin ligase, DNA binding | 99.47 | |
| 2ct2_A | 88 | Tripartite motif protein 32; zinc-finger protein H | 99.46 | |
| 3ng2_A | 71 | RNF4, snurf, ring finger protein 4; ring domain, E | 99.46 | |
| 2ea6_A | 69 | Ring finger protein 4; RNF4, RES4-26, ring domain, | 99.45 | |
| 1t1h_A | 78 | Gspef-atpub14, armadillo repeat containing protein | 99.45 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 99.44 | |
| 1v87_A | 114 | Deltex protein 2; ring-H2 domain, zinc-binding dom | 99.44 | |
| 1x4j_A | 75 | Ring finger protein 38; structural genomics, NPPSF | 99.44 | |
| 2xeu_A | 64 | Ring finger protein 4; transcription, zinc-finger, | 99.43 | |
| 2csy_A | 81 | Zinc finger protein 183-like 1; ring finger protei | 99.43 | |
| 2ect_A | 78 | Ring finger protein 126; metal binding protein, st | 99.43 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 99.43 | |
| 2l0b_A | 91 | E3 ubiquitin-protein ligase praja-1; zinc finger, | 99.43 | |
| 2yur_A | 74 | Retinoblastoma-binding protein 6; P53-associated c | 99.42 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 99.42 | |
| 2ecl_A | 81 | Ring-box protein 2; RNF7, ring domian, zinc-bindin | 99.42 | |
| 1e4u_A | 78 | Transcriptional repressor NOT4; gene regulation, t | 99.41 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 99.4 | |
| 3hct_A | 118 | TNF receptor-associated factor 6; cross-brace, bet | 99.4 | |
| 4ayc_A | 138 | E3 ubiquitin-protein ligase RNF8; DNA damage, K63 | 99.39 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 99.38 | |
| 3ztg_A | 92 | E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR | 99.37 | |
| 2ysj_A | 63 | Tripartite motif-containing protein 31; ring-type | 99.37 | |
| 3fl2_A | 124 | E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA | 99.37 | |
| 2egp_A | 79 | Tripartite motif-containing protein 34; ZF-C3HC4 d | 99.36 | |
| 2ecw_A | 85 | Tripartite motif-containing protein 30; metal bind | 99.34 | |
| 1chc_A | 68 | Equine herpes virus-1 ring domain; viral protein; | 99.34 | |
| 3l11_A | 115 | E3 ubiquitin-protein ligase RNF168; E3 ligase, rin | 99.33 | |
| 1rmd_A | 116 | RAG1; V(D)J recombination, antibody, MAD, ring fin | 99.33 | |
| 2ecn_A | 70 | Ring finger protein 141; RNF141, ring domain, zinc | 99.32 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 99.31 | |
| 2ecj_A | 58 | Tripartite motif-containing protein 39; TRIM39, ri | 99.31 | |
| 3dpl_R | 106 | Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST | 99.31 | |
| 1z6u_A | 150 | NP95-like ring finger protein isoform B; structura | 99.31 | |
| 2ecv_A | 85 | Tripartite motif-containing protein 5; metal bindi | 99.3 | |
| 2ckl_A | 108 | Polycomb group ring finger protein 4; BMI1, RING1B | 99.29 | |
| 2y43_A | 99 | E3 ubiquitin-protein ligase RAD18; DNA repair, met | 99.29 | |
| 2ckl_B | 165 | Ubiquitin ligase protein RING2; BMI1, RING1B, poly | 99.24 | |
| 1jm7_A | 112 | BRCA1, breast cancer type 1 susceptibility protein | 99.23 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 99.21 | |
| 2vje_A | 64 | E3 ubiquitin-protein ligase MDM2; proto-oncogene, | 99.2 | |
| 2kr4_A | 85 | Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri | 99.2 | |
| 1bor_A | 56 | Transcription factor PML; proto-oncogene, nuclear | 99.2 | |
| 3knv_A | 141 | TNF receptor-associated factor 2; cross-brace, alt | 99.18 | |
| 2kre_A | 100 | Ubiquitin conjugation factor E4 B; U-box domain, E | 99.17 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 99.17 | |
| 4ic3_A | 74 | E3 ubiquitin-protein ligase XIAP; ring domain, zin | 99.14 | |
| 2d8s_A | 80 | Cellular modulator of immune recognition; C-MIR, m | 99.14 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 99.13 | |
| 1wgm_A | 98 | Ubiquitin conjugation factor E4A; ubiquitinating e | 99.13 | |
| 2vje_B | 63 | MDM4 protein; proto-oncogene, phosphorylation, alt | 99.12 | |
| 4a0k_B | 117 | E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi | 99.11 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 99.11 | |
| 2yu4_A | 94 | E3 SUMO-protein ligase NSE2; SP-ring domain, struc | 99.07 | |
| 2y1n_A | 389 | E3 ubiquitin-protein ligase; ligase-transferase co | 99.02 | |
| 2ecg_A | 75 | Baculoviral IAP repeat-containing protein 4; BIRC4 | 98.98 | |
| 2f42_A | 179 | STIP1 homology and U-box containing protein 1; cha | 98.95 | |
| 2yho_A | 79 | E3 ubiquitin-protein ligase mylip; ligase, E2 liga | 98.92 | |
| 2ea5_A | 68 | Cell growth regulator with ring finger domain prot | 98.92 | |
| 1wim_A | 94 | KIAA0161 protein; ring finger domain, UBCM4-intera | 98.89 | |
| 2ct0_A | 74 | Non-SMC element 1 homolog; ring domain, structural | 98.82 | |
| 3htk_C | 267 | E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- | 98.74 | |
| 1vyx_A | 60 | ORF K3, K3RING; zinc-binding protein, ring domain, | 98.66 | |
| 3t6p_A | 345 | Baculoviral IAP repeat-containing protein 2; ring, | 98.65 | |
| 2bay_A | 61 | PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l | 98.54 | |
| 3k1l_B | 381 | Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A | 98.48 | |
| 3vk6_A | 101 | E3 ubiquitin-protein ligase hakai; HYB, phosphotyr | 98.33 | |
| 3nw0_A | 238 | Non-structural maintenance of chromosomes element | 97.16 | |
| 2ko5_A | 99 | Ring finger protein Z; lassa fever virus-Z, negati | 96.52 | |
| 2jun_A | 101 | Midline-1; B-BOX, TRIM, ring finger, alternative s | 96.48 | |
| 2ysm_A | 111 | Myeloid/lymphoid or mixed-lineage leukemia protein | 92.86 | |
| 2lri_C | 66 | Autoimmune regulator; Zn binding protein domain, a | 92.55 | |
| 1weo_A | 93 | Cellulose synthase, catalytic subunit (IRX3); stru | 92.4 | |
| 2lbm_A | 142 | Transcriptional regulator ATRX; metal binding prot | 91.62 | |
| 1f62_A | 51 | Transcription factor WSTF; Zn-finger; NMR {Homo sa | 89.29 | |
| 3v43_A | 112 | Histone acetyltransferase KAT6A; MOZ, PHD finger, | 88.14 | |
| 2l5u_A | 61 | Chromodomain-helicase-DNA-binding protein 4; CHD4, | 87.43 | |
| 1mm2_A | 61 | MI2-beta; PHD, zinc finger, protein scaffold, DNA | 85.29 | |
| 3ql9_A | 129 | Transcriptional regulator ATRX; zinc finger, trans | 84.99 | |
| 3m62_A | 968 | Ubiquitin conjugation factor E4; armadillo-like re | 84.6 | |
| 1we9_A | 64 | PHD finger family protein; structural genomics, PH | 82.87 | |
| 3asl_A | 70 | E3 ubiquitin-protein ligase UHRF1; histone reader | 82.11 | |
| 2k16_A | 75 | Transcription initiation factor TFIID subunit 3; p | 81.84 | |
| 3shb_A | 77 | E3 ubiquitin-protein ligase UHRF1; unmodified hist | 81.55 | |
| 3u5n_A | 207 | E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b | 81.54 | |
| 2e6s_A | 77 | E3 ubiquitin-protein ligase UHRF2; PHD domain, str | 80.87 | |
| 2kdx_A | 119 | HYPA, hydrogenase/urease nickel incorporation prot | 80.86 | |
| 1wil_A | 89 | KIAA1045 protein; ring finger domain, structural g | 80.84 |
| >2k2d_A Ring finger and CHY zinc finger domain- containing protein 1; zinc-binding protein, cytoplasm, metal-binding, nucleus, metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.82 E-value=2.3e-21 Score=125.47 Aligned_cols=77 Identities=45% Similarity=0.795 Sum_probs=41.9
Q ss_pred CCCCCCCCchhhhHHHHHHHHHhcCCCChhhhcccceecCCCCCCCcccceeeeccccccCCCcccccccCCCCCCC
Q 032467 55 CPVCSKSLWDMSKLWSKIDQEIASTPMPAMYQNKMVWILCNDCGANSHVQFHVIAHKCLSCKSYNTRQTRGDTATTC 131 (140)
Q Consensus 55 CP~CR~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~i~C~~C~~~~~~~~~~~~~~C~~C~~~~~~~~~~~~~~~~ 131 (140)
||+|.+++.+|+..|+.|+.+++.++||++|++.+++|+|+||++++.+.+|+++++|+.|+|||++.+.|..+|+.
T Consensus 1 ~~~c~ks~~dm~~~~~~lD~~ia~~pmP~~y~~~~v~I~CnDC~~~s~v~~h~lg~kC~~C~SyNTr~~~G~~~~~~ 77 (79)
T 2k2d_A 1 GSHMMHSALDMTRYWRQLDDEVAQTPMPSEYQNMTVDILCNDCNGRSTVQFHILGMKCKICESYNTAQAGGRRISLD 77 (79)
T ss_dssp --------------------------------CCEEEEEESSSCCEEEEECCTTCCCCTTTSCCCEEESCCCCCCCC
T ss_pred CCcccccHHHHHHHHHHHHHHHHhCCCCHHHhCCEeEEECCCCCCCccCCceeecccCcCCCCcCeEecCCCCCCCC
Confidence 89999999999999999999999999999999999999999999999999999999999999999999998766654
|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A | Back alignment and structure |
|---|
| >2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A | Back alignment and structure |
|---|
| >4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A | Back alignment and structure |
|---|
| >2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A | Back alignment and structure |
|---|
| >2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* | Back alignment and structure |
|---|
| >4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* | Back alignment and structure |
|---|
| >2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C | Back alignment and structure |
|---|
| >2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A | Back alignment and structure |
|---|
| >2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 | Back alignment and structure |
|---|
| >3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B | Back alignment and structure |
|---|
| >2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A | Back alignment and structure |
|---|
| >3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} | Back alignment and structure |
|---|
| >2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1weo_A Cellulose synthase, catalytic subunit (IRX3); structure genomics, ring-finger, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A | Back alignment and structure |
|---|
| >1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A | Back alignment and structure |
|---|
| >2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A | Back alignment and structure |
|---|
| >3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A | Back alignment and structure |
|---|
| >3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A | Back alignment and structure |
|---|
| >1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B | Back alignment and structure |
|---|
| >2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* | Back alignment and structure |
|---|
| >3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* | Back alignment and structure |
|---|
| >2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kdx_A HYPA, hydrogenase/urease nickel incorporation protein HYPA; metallochaperone, metal-binding, metal- binding protein; NMR {Helicobacter pylori} | Back alignment and structure |
|---|
| >1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 140 | ||||
| d1fbva4 | 79 | g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta | 2e-06 | |
| d1ur6b_ | 52 | g.44.1.1 (B:) Not-4 N-terminal RING finger domain | 9e-05 | |
| d1iyma_ | 55 | g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati | 2e-04 | |
| d1jm7a_ | 103 | g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie | 2e-04 | |
| d1rmda2 | 86 | g.44.1.1 (A:1-86) V(D)J recombination activating p | 2e-04 | |
| d1bora_ | 56 | g.44.1.1 (A:) Acute promyelocytic leukaemia proto- | 3e-04 | |
| d1chca_ | 68 | g.44.1.1 (A:) Immediate early protein, IEEHV {Equi | 4e-04 | |
| d1g25a_ | 65 | g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi | 6e-04 |
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
class: Small proteins fold: RING/U-box superfamily: RING/U-box family: RING finger domain, C3HC4 domain: CBL species: Human (Homo sapiens) [TaxId: 9606]
Score = 40.8 bits (95), Expect = 2e-06
Identities = 14/47 (29%), Positives = 20/47 (42%), Gaps = 4/47 (8%)
Query: 16 CPICFEFIFDTMKDITVLRCGHTIHLECLKEMEKHYRYTCPVCSKSL 62
C IC E KD+ + CGH + CL ++ CP C +
Sbjct: 26 CKICAE----NDKDVKIEPCGHLMCTSCLTSWQESEGQGCPFCRCEI 68
|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 140 | |||
| d1ur6b_ | 52 | Not-4 N-terminal RING finger domain {Human (Homo s | 99.63 | |
| d1iyma_ | 55 | EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 | 99.57 | |
| d1g25a_ | 65 | TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 | 99.53 | |
| d1fbva4 | 79 | CBL {Human (Homo sapiens) [TaxId: 9606]} | 99.52 | |
| d1rmda2 | 86 | V(D)J recombination activating protein 1 (RAG1), d | 99.47 | |
| d1chca_ | 68 | Immediate early protein, IEEHV {Equine herpesvirus | 99.42 | |
| d1v87a_ | 114 | Deltex protein 2 RING-H2 domain {Mouse (Mus muscul | 99.42 | |
| d2c2la2 | 80 | STIP1 homology and U box-containing protein 1, STU | 99.41 | |
| d3dplr1 | 88 | RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase | 99.38 | |
| d1jm7a_ | 103 | brca1 RING domain {Human (Homo sapiens) [TaxId: 96 | 99.37 | |
| d1t1ha_ | 78 | E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi | 99.35 | |
| d1bora_ | 56 | Acute promyelocytic leukaemia proto-oncoprotein PM | 99.32 | |
| d2baya1 | 56 | Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac | 99.3 | |
| d1jm7b_ | 97 | bard1 RING domain {Human (Homo sapiens) [TaxId: 96 | 99.22 | |
| d1vyxa_ | 60 | IE1B protein (ORF K3), N-terminal domain {Kaposi's | 99.19 | |
| d1wgma_ | 98 | Ubiquitin conjugation factor E4A {Human (Homo sapi | 98.89 | |
| d1wima_ | 94 | UbcM4-interacting protein 4 (KIAA0161) {Human (Hom | 98.73 | |
| d1f62a_ | 51 | Williams-Beuren syndrome transcription factor, WST | 92.9 | |
| d1weoa_ | 93 | Cellulose synthase A catalytic subunit 7, IRX3 {Th | 91.64 | |
| d1we9a_ | 64 | PHD finger protein At5g26210 {Thale cress (Arabido | 91.37 | |
| d2cs3a1 | 80 | Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [ | 88.98 | |
| d1mm2a_ | 61 | Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 | 87.05 | |
| d1fp0a1 | 70 | Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo | 86.43 | |
| d2jnea1 | 71 | Hypothetical protein YfgJ {Escherichia coli [TaxId | 86.02 | |
| d1wewa_ | 78 | Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop | 82.58 | |
| d1wila_ | 89 | Hypothetical protein KIAA1045 {Human (Homo sapiens | 81.96 | |
| d1joca1 | 64 | Eea1 {Human (Homo sapiens) [TaxId: 9606]} | 80.93 | |
| d1weva_ | 88 | PHD finger protein 22 {Mouse (Mus musculus) [TaxId | 80.29 |
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Small proteins fold: RING/U-box superfamily: RING/U-box family: RING finger domain, C3HC4 domain: Not-4 N-terminal RING finger domain species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.63 E-value=3.3e-17 Score=96.50 Aligned_cols=50 Identities=24% Similarity=0.469 Sum_probs=42.3
Q ss_pred cccccccccccccCCccEEecCCCcccHHHHHhhhccccCCCCCCCCCCc
Q 032467 14 HNCPICFEFIFDTMKDITVLRCGHTIHLECLKEMEKHYRYTCPVCSKSLW 63 (140)
Q Consensus 14 ~~C~IC~e~l~~~~~~~~~l~CgH~Fc~~Cl~~~~~~~~~~CP~CR~~~~ 63 (140)
++||||+++|......+..++|||.||..||.+|+..++.+||+||+.+.
T Consensus 1 leCpICl~~~~~~~~~~~~~~CgH~~c~~C~~~w~~~~~~~CP~CR~~~~ 50 (52)
T d1ur6b_ 1 VECPLCMEPLEIDDINFFPCTCGYQICRFCWHRIRTDENGLCPACRKPYP 50 (52)
T ss_dssp CEETTTTEECCGGGTTCCSSSSSCCCCHHHHHHHTTTSCCBCTTTCCBCS
T ss_pred CCCcCCChhhhCCCceEEecCCCCccchHHHHHHHhhcCCCCCccCCcCC
Confidence 47999999876555556667999999999999999876678999999874
|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} | Back information, alignment and structure |
|---|
| >d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1weoa_ g.44.1.1 (A:) Cellulose synthase A catalytic subunit 7, IRX3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2cs3a1 g.44.1.3 (A:8-87) Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2jnea1 g.41.18.1 (A:1-71) Hypothetical protein YfgJ {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1joca1 g.50.1.1 (A:1348-1411) Eea1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|