Citrus Sinensis ID: 032480


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140
MAGVGEAQRRQAGRSRPLHPSGRGPPPPPPRPRFEPVDREKTCPLLLRVFTKIGGHHSREDFAVRGKEPKDEVQIYTWKDATLRELTDLVKEVAPAARRRDARLSFAFVYPDKNGRFMVREVSHSSLTVSYLGHDQSAMN
cccccHHHHHccccccccccccccccccccccccccccccccccEEEEEEEccccccccccccccccccccccEEEEcccccHHHHHHHHHHHcccccccccEEEEEEEECcccccccEEEccEEEEccccccccccccc
****************************************KTCPLLLRVFTKIGGHHSREDFAVRG*EPKDEVQIYTWKDATLRELTDLVKEVAPAARRRDARLSFAFVYPDKNGRFMVREVSHSSLTVS**********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAGVGEAQRRQAGRSRPLHPSGRGPPPPPPRPRFEPVDREKTCPLLLRVFTKIGGHHSREDFAVRGKEPKDEVQIYTWKDATLRELTDLVKEVAPAARRRDARLSFAFVYPDKNGRFMVREVSHSSLTVSYLGHDQSAMN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Histone deacetylase complex subunit SAP18 Links the histone deacetylase complex to transcriptional repressors bound to chromatin. Involved in the tethering of the SIN3 complex to core histone proteins.probableO64644

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4A6Q, chain A
Confidence level:very confident
Coverage over the Query: 32-137
View the alignment between query and template
View the model in PyMOL
Template: 1J8C, chain A
Confidence level:probable
Coverage over the Query: 74-94
View the alignment between query and template
View the model in PyMOL