Citrus Sinensis ID: 032482


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140
MVSFEMNDRKKIGLGLTGFGIFFTFLGIIFFFDKGLLAMGNILFIAGVSLTIGLKSTMQFFMKRQNYKGTISFGVGFFFVVIGWPILGMILETYGFIVLFSGFWPTLSVFLQRIPILGWLFQQPFVRSFFDRYRSRRVPV
ccCEECccccEEEHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHcHHHHHHHHHcccccEEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHcccccccccccHHHHHHHHHHccccccc
*******DRKKIGLGLTGFGIFFTFLGIIFFFDKGLLAMGNILFIAGVSLTIGLKSTMQFFMKRQNYKGTISFGVGFFFVVIGWPILGMILETYGFIVLFSGFWPTLSVFLQRIPILGWLFQQPFVRSFFDRYRSRRV**
xxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVSFEMNDRKKIGLGLTGFGIFFTFLGIIFFFDKGLLAMGNILFIAGVSLTIGLKSTMQFFMKRQNYKGTISFGVGFFFVVIGWPILGMILETYGFIVLFSGFWPTLSVFLQRIPILGWLFQQPFVRSFFDRYRSRRVPV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Vesicle transport protein GOT1B May be involved in fusion of ER-derived transport vesicles with the Golgi complex.probableQ9Y3E0
Protein transport protein got1 Nonessential protein required for the fusion of ER-derived transport vesicles with the Golgi complex. Can be replaced by sft2.probableQ9USJ2
Vesicle transport protein GOT1A May be involved in fusion of ER-derived transport vesicles with the Golgi complex.probableQ2NKV8

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

No confident structure templates for the query are predicted