Citrus Sinensis ID: 032499

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------14
MKASLKGRYETDKDRGVAAATVAFNAGDVKLRASLTDATVVNGPSLNGLALAVEKPGFFIVDYNVPKKDFRFQFMNSVRVADKPLNLTYIHGRGDNRTILEGTLVFDSANKVSANHVLGSGNCKLKYTYVHGGLTTFEQ
cccEEEEEECccccccEEEEEEEEccccEEEEEEEEEEEECcccccccEEEEEEcccEEEEECccccccCEEEEEEEEEEccCEEEEEEEECccccCEEEEEEEEEEccccEEEEEEEccccCEEEEEEECccCEEECc
******G***TDKDRGVAAATVAFNAGDVKLRASLTDATVVNGPSLNGLALAVEKPGFFIVDYNVPKKDFRFQFMNSVRVADKPLNLTYIHGRGDNRTILEGTLVFDSANKVSANHVLGSGNCKLKYTYVHGGLTT***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKASLKGRYETDKDRGVAAATVAFNAGDVKLRASLTDATVVNGPSLNGLALAVEKPGFFIVDYNVPKKDFRFQFMNSVRVADKPLNLTYIHGRGDNRTILEGTLVFDSANKVSANHVLGSGNCKLKYTYVHGGLTTFEQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Outer envelope pore protein 24B, chloroplastic High-conductance voltage-dependent solute channel with a slight selectivity for cations transporting triosephosphates, dicarboxylic acids, ATP, inorganic phosphate (Pi), sugars, and positively or negatively charged amino acids.probableQ8H0Y1
Outer envelope pore protein 24, chloroplastic High-conductance voltage-dependent solute channel with a slight selectivity for cations transporting triosephosphates, dicarboxylic acids, ATP, inorganic phosphate (Pi), sugars, and positively or negatively charged amino acids.probableO49929

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

No confident structure templates for the query are predicted