Citrus Sinensis ID: 032503


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------14
MTAAADSVQKTEEEWRAILSPEQFRILRQKGTEPRGTGEYNKLYADGFYNCAGCGTALYKSVTKFDSGCGWPAFYEGLPGAINRSPDPDGRRTEITCAACGGHMGHVFKGEGFKTPTDERHCVNSVSIKFIPGDAPASS
cccccccccccHHHHHHHccHHHHHHHHHcccccccccccccccccCEEEcccccccccccccccccccccccccccccccEEEcccccccccEEEccccccccccEEccccccccccccccccccccEEccccccccc
***********EEEWRAILSPEQFRILRQKGTEPRGTGEYNKLYADGFYNCAGCGTALYKSVTKFDSGCGWPAFYEGLPGAINRSPDPDGRRTEITCAACGGHMGHVFKGEGFKTPTDERHCVNSVSIKFI********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTAAADSVQKTEEEWRAILSPEQFRILRQKGTEPRGTGEYNKLYADGFYNCAGCGTALYKSVTKFDSGCGWPAFYEGLPGAINRSPDPDGRRTEITCAACGGHMGHVFKGEGFKTPTDERHCVNSVSIKFIPGDAPASS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Peptide methionine sulfoxide reductase B5 Catalyzes the reduction of methionine sulfoxide (MetSO) to methionine in proteins. Plays a protective role against oxidative stress by restoring activity to proteins that have been inactivated by methionine oxidation. MSRB family specifically reduces the MetSO R-enantiomer.confidentQ10L32
Uncharacterized protein C216.04c probableQ9Y7K1
Peptide methionine sulfoxide reductase MsrB probableQ6ADJ8

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
1.-.-.-Oxidoreductases.probable
1.8.-.-Acting on a sulfur group of donors.probable
1.8.4.-With a disulfide as acceptor.probable
1.8.4.12Peptide-methionine (R)-S-oxide reductase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2K8D, chain A
Confidence level:very confident
Coverage over the Query: 6-135
View the alignment between query and template
View the model in PyMOL