Citrus Sinensis ID: 032505

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------14
MSLMMSGGDLGVSAFPEGESIFTWIGTIEGGKGTMYEGLSYKLSLRFPLDYPFKPPQVKFETMCFHPNVDQYGNICLDILQDKWSSAYDCRTILLSIQSLLGEPNPESPLNSYAAALLNNKEDYRKMVQKQYFAGEFES
ccccccccccccEEEEcccccEEEEEEEEccccccccccEEEEEEEccccccccccEEEECcccccccccccccEEEEccccccccHccHHHHHHHHHHHcccccccccccHHHHHHHccHHHHHHHHHHHHHHccccc
*S*****GDLGVSAFPEGESIFTWIGTIEGGKGTMYEGLSYKLSLRFPLDYPFKPPQVKFETMCFHPNVDQYGNICLDILQDKWSSAYDCRTILLSIQSLLGEPNPESPLNSYAAALLNNKEDYRKMVQKQY*******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSLMMSGGDLGVSAFPEGESIFTWIGTIEGGKGTMYEGLSYKLSLRFPLDYPFKPPQVKFETMCFHPNVDQYGNICLDILQDKWSSAYDCRTILLSIQSLLGEPNPESPLNSYAAALLNNKEDYRKMVQKQYFAGEFES

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable ubiquitin-conjugating enzyme E2 C Catalyzes the covalent attachment of ubiquitin to other proteins. Acts as an essential factor of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated ubiquitin ligase that controls progression through mitosis. Acts by initiating polyubiquitin chains on APC/C substrates, leading to the degradation of APC/C substrates by the proteasome and promoting mitotic exit.probableQ54XS6
Ubiquitin-conjugating enzyme E2 19 Accepts the ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. Part of the anaphase-promoting complex (APC). May have a key function during cell cycle and be involved in cyclin B1 degradation.probableQ9LJZ5
Ubiquitin-conjugating enzyme E2-18 kDa Catalyzes the covalent attachment of ubiquitin to other proteins.probableP52492

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
6.-.-.-Ligases.probable
6.3.-.-Forming carbon-nitrogen bonds.probable
6.3.2.-Acid--D-amino-acid ligases (peptide synthases).probable
6.3.2.19Ubiquitin--protein ligase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2R0J, chain A
Confidence level:very confident
Coverage over the Query: 2-138
View the alignment between query and template
View the model in PyMOL