Citrus Sinensis ID: 032513

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------14
MVICHAGHVNHSIFWKNLAPVHEGGGEPPHSSLGWAIDTHFGSLEALIQKMSAEGAALQGSGWVWLGLDTEFKRLVVETTANQDPLVTKAPTLVPLLGIDVWEHAYYLQYKNVKPDYLKNIWNVMNWKYASDVYQKECP
cccccccccHHHHHccccccccccccccccHHHHHHHHHccccHHHHHHHHHHHHHHcccccEEEEEEEccccEEEEEEccccccccccccccccEEEEEHHHHHHccccccccHHHHHHHHHcccHHHHHHHHHHHcc
MVICHAGHVNHSIFWKNLAPVHEG******SSLGWAIDTHFGSLEALIQKMSAEGAALQGSGWVWLGLDTEFKRLVVETTANQDPLVTKAPTLVPLLGIDVWEHAYYLQYKNVKPDYLKNIWNVMNWKYASDVYQ****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVICHAGHVNHSIFWKNLAPVHEGGGEPPHSSLGWAIDTHFGSLEALIQKMSAEGAALQGSGWVWLGLDTEFKRLVVETTANQDPLVTKAPTLVPLLGIDVWEHAYYLQYKNVKPDYLKNIWNVMNWKYASDVYQKECP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Superoxide dismutase [Mn], mitochondrial Destroys superoxide anion radicals which are normally produced within the cells and which are toxic to biological systems.probableQ8HXP7
Superoxide dismutase [Mn], mitochondrial (Fragment) Destroys superoxide anion radicals which are normally produced within the cells and which are toxic to biological systems.probableP41982
Superoxide dismutase [Mn], mitochondrial Destroys superoxide anion radicals which are normally produced within the cells and which are toxic to biological systems.probableQ43008

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
1.-.-.-Oxidoreductases.probable
1.15.-.-Acting on superoxide as acceptor.probable
1.15.1.-Acting on superoxide as acceptor.probable
1.15.1.1Superoxide dismutase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3RN4, chain A
Confidence level:very confident
Coverage over the Query: 2-137
View the alignment between query and template
View the model in PyMOL