Citrus Sinensis ID: 032513

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------14
MVICHAGHVNHSIFWKNLAPVHEGGGEPPHSSLGWAIDTHFGSLEALIQKMSAEGAALQGSGWVWLGLDTEFKRLVVETTANQDPLVTKAPTLVPLLGIDVWEHAYYLQYKNVKPDYLKNIWNVMNWKYASDVYQKECP
cccccccccHHHHHccccccccccccccccHHHHHHHHHccccHHHHHHHHHHHHHHcccccEEEEEEEccccEEEEEEccccccccccccccccEEEEEHHHHHHccccccccHHHHHHHHHcccHHHHHHHHHHHcc
cccccHHHHHHHHHHHHEccHHHcEcccccHHHHHHHHHHHccHHHHHHHHHHHHHcccccEEEEEEEEccccEEEEEEEEccccHccccccEEEEEEEEccHHHcHHHHcccHHHHHHHHHHcEcHHHHHcccHcHcc
mvichaghvnhsifwknlapvhegggepphsslgwaidtHFGSLEALIQKMSAEGAALQGSGWVWLGLDTEFKRLVVETtanqdplvtkaptlvpllgidVWEHAYYLQyknvkpdyLKNIWNVMNWKYASDVYQKECP
mvichaghVNHSIFWKNLAPVHEGGGEPPHSSLGWAIDTHFGSLEALIQKMSAEGAALQGSGWVWLGLDTEFKRLVVEttanqdplvtkaptlVPLLGIDVWEHAYYLQYKNVKPDYLKNIWNVMNWKYASDVYQKECP
MVICHAGHVNHSIFWKNLAPVHEGGGEPPHSSLGWAIDTHFGSLEALIQKMSAEGAALQGSGWVWLGLDTEFKRLVVETTANQDPLVTKAPTLVPLLGIDVWEHAYYLQYKNVKPDYLKNIWNVMNWKYASDVYQKECP
*VICHAGHVNHSIFWKNLAPVHEG******SSLGWAIDTHFGSLEALIQKMSAEGAALQGSGWVWLGLDTEFKRLVVETTANQDPLVTKAPTLVPLLGIDVWEHAYYLQYKNVKPDYLKNIWNVMNWKYASDVY*****
MVICHAGHVNHSIFWKN***************LGWAIDTHFGSLEALIQKMSAEGAALQGSGWVWLGLDTEFKRLVVETTANQDPLVTKAPTLVPLLGIDVWEHAYYLQYKNVKPDYLKNIWNVMNWKYASDVYQ****
MVICHAGHVNHSIFWKNLAPVHEGGGEPPHSSLGWAIDTHFGSLEALIQKMSAEGAALQGSGWVWLGLDTEFKRLVVETTANQDPLVTKAPTLVPLLGIDVWEHAYYLQYKNVKPDYLKNIWNVMNWKYASDVYQKECP
MVICHAGHVNHSIFWKNLAPVHEGGGEPPHSSLGWAIDTHFGSLEALIQKMSAEGAALQGSGWVWLGLDTEFKRLVVETTANQDPLVTKAPTLVPLLGIDVWEHAYYLQYKNVKPDYLKNIWNVMNWKYASDVYQK*C*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVICHAGHVNHSIFWKNLAPVHEGGGEPPHSSLGWAIDTHFGSLEALIQKMSAEGAALQGSGWVWLGLDTEFKRLVVETTANQDPLVTKAPTLVPLLGIDVWEHAYYLQYKNVKPDYLKNIWNVMNWKYASDVYQKECP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query139 2.2.26 [Sep-21-2011]
Q9SM64228 Superoxide dismutase [Mn] N/A no 0.964 0.587 0.858 6e-66
P11796228 Superoxide dismutase [Mn] N/A no 0.964 0.587 0.843 9e-66
P35017233 Superoxide dismutase [Mn] N/A no 0.964 0.575 0.865 3e-65
O49066228 Superoxide dismutase [Mn] N/A no 0.964 0.587 0.835 1e-64
O81235231 Superoxide dismutase [Mn] yes no 0.949 0.571 0.803 9e-61
P09233235 Superoxide dismutase [Mn] N/A no 0.928 0.548 0.798 3e-59
P41979233 Superoxide dismutase [Mn] N/A no 0.935 0.557 0.784 5e-59
P41980233 Superoxide dismutase [Mn] N/A no 0.935 0.557 0.792 7e-59
Q43008231 Superoxide dismutase [Mn] yes no 0.928 0.558 0.798 1e-58
Q9LYK8241 Superoxide dismutase [Mn] no no 0.949 0.547 0.780 1e-58
>sp|Q9SM64|SODM_PRUPE Superoxide dismutase [Mn], mitochondrial OS=Prunus persica GN=SOD PE=2 SV=1 Back     alignment and function desciption
 Score =  248 bits (634), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 115/134 (85%), Positives = 124/134 (92%)

Query: 6   AGHVNHSIFWKNLAPVHEGGGEPPHSSLGWAIDTHFGSLEALIQKMSAEGAALQGSGWVW 65
            GH+NHSIFWKNLAPV EGGGEPP  SLGWAIDT+FGSLEAL+QKM+AEGAALQGSGWVW
Sbjct: 95  GGHINHSIFWKNLAPVREGGGEPPKGSLGWAIDTNFGSLEALVQKMNAEGAALQGSGWVW 154

Query: 66  LGLDTEFKRLVVETTANQDPLVTKAPTLVPLLGIDVWEHAYYLQYKNVKPDYLKNIWNVM 125
           L LD E K+LVVETTANQDPLVTK PTLVPLLGIDVWEHAYYLQYKNV+PDYLKNIW V+
Sbjct: 155 LALDKELKKLVVETTANQDPLVTKGPTLVPLLGIDVWEHAYYLQYKNVRPDYLKNIWKVI 214

Query: 126 NWKYASDVYQKECP 139
           NWKYAS+VY+KE P
Sbjct: 215 NWKYASEVYEKESP 228
Destroys superoxide anion radicals which are normally produced within the cells and which are toxic to biological systems.
Prunus persica (taxid: 3760)
EC: 1EC: .EC: 1EC: 5EC: .EC: 1EC: .EC: 1
>sp|P11796|SODM_NICPL Superoxide dismutase [Mn], mitochondrial OS=Nicotiana plumbaginifolia GN=SODA PE=1 SV=1 Back     alignment and function description
>sp|P35017|SODM_HEVBR Superoxide dismutase [Mn], mitochondrial OS=Hevea brasiliensis GN=SODA PE=2 SV=1 Back     alignment and function description
>sp|O49066|SODM_CAPAN Superoxide dismutase [Mn], mitochondrial OS=Capsicum annuum GN=SODA PE=2 SV=1 Back     alignment and function description
>sp|O81235|SODM1_ARATH Superoxide dismutase [Mn] 1, mitochondrial OS=Arabidopsis thaliana GN=MSD1 PE=1 SV=2 Back     alignment and function description
>sp|P09233|SODM1_MAIZE Superoxide dismutase [Mn] 3.1, mitochondrial OS=Zea mays GN=SODA.4 PE=2 SV=1 Back     alignment and function description
>sp|P41979|SODM3_MAIZE Superoxide dismutase [Mn] 3.3, mitochondrial OS=Zea mays GN=SODA.2 PE=2 SV=1 Back     alignment and function description
>sp|P41980|SODM4_MAIZE Superoxide dismutase [Mn] 3.4, mitochondrial OS=Zea mays GN=SODA.3 PE=2 SV=1 Back     alignment and function description
>sp|Q43008|SODM_ORYSJ Superoxide dismutase [Mn], mitochondrial OS=Oryza sativa subsp. japonica GN=SODA PE=2 SV=2 Back     alignment and function description
>sp|Q9LYK8|SODM2_ARATH Superoxide dismutase [Mn] 2, mitochondrial OS=Arabidopsis thaliana GN=MSD2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query139
381141814228 Mn/Fe superoxide dismutase [Tetradium ru 0.964 0.587 0.962 3e-72
283101130228 manganese superoxide dismutase [Citrus j 0.964 0.587 0.962 2e-71
380294774232 manganese superoxide dismutase [Salicorn 0.964 0.577 0.865 3e-65
386870491225 anganese superoxide dismutase [Sesamum i 0.964 0.595 0.873 5e-65
149786150230 manganese superoxide dismutase-like prot 0.964 0.582 0.850 1e-64
255559673234 superoxide dismutase [mn], putative [Ric 0.964 0.572 0.858 2e-64
255633168 240 unknown [Glycine max] 0.956 0.554 0.864 4e-64
37999810228 RecName: Full=Superoxide dismutase [Mn], 0.964 0.587 0.858 5e-64
351726054 241 MnSOD [Glycine max] gi|356516259|ref|XP_ 0.956 0.551 0.864 6e-64
134672228 RecName: Full=Superoxide dismutase [Mn], 0.964 0.587 0.843 7e-64
>gi|381141814|gb|AFF57843.1| Mn/Fe superoxide dismutase [Tetradium ruticarpum] Back     alignment and taxonomy information
 Score =  275 bits (704), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 129/134 (96%), Positives = 132/134 (98%)

Query: 6   AGHVNHSIFWKNLAPVHEGGGEPPHSSLGWAIDTHFGSLEALIQKMSAEGAALQGSGWVW 65
            GHVNHSIFWKNLAPVHEGGGEPPHSSLGWAIDTHFGSLEALIQKM+AEGAALQGSGWVW
Sbjct: 95  GGHVNHSIFWKNLAPVHEGGGEPPHSSLGWAIDTHFGSLEALIQKMNAEGAALQGSGWVW 154

Query: 66  LGLDTEFKRLVVETTANQDPLVTKAPTLVPLLGIDVWEHAYYLQYKNVKPDYLKNIWNVM 125
           LGLDTEFKRLVVETTANQDPLVTKAPTLVPLLGIDVWEHAYYLQYKNV+PDYLKNIW VM
Sbjct: 155 LGLDTEFKRLVVETTANQDPLVTKAPTLVPLLGIDVWEHAYYLQYKNVRPDYLKNIWKVM 214

Query: 126 NWKYASDVYQKECP 139
           NWKYAS+VYQKECP
Sbjct: 215 NWKYASEVYQKECP 228

Source: Tetradium ruticarpum

Species: Tetradium ruticarpum

Genus: Tetradium

Family: Rutaceae

Order: Sapindales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|283101130|gb|ADB10839.1| manganese superoxide dismutase [Citrus japonica] Back     alignment and taxonomy information
>gi|380294774|gb|AFD50703.1| manganese superoxide dismutase [Salicornia europaea] Back     alignment and taxonomy information
>gi|386870491|gb|AFJ42576.1| anganese superoxide dismutase [Sesamum indicum] Back     alignment and taxonomy information
>gi|149786150|gb|ABR29644.1| manganese superoxide dismutase-like protein [Pistacia vera] Back     alignment and taxonomy information
>gi|255559673|ref|XP_002520856.1| superoxide dismutase [mn], putative [Ricinus communis] gi|223539987|gb|EEF41565.1| superoxide dismutase [mn], putative [Ricinus communis] Back     alignment and taxonomy information
>gi|255633168|gb|ACU16940.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|37999810|sp|Q9SM64.1|SODM_PRUPE RecName: Full=Superoxide dismutase [Mn], mitochondrial; Flags: Precursor gi|6006619|emb|CAB56851.1| manganese superoxide dismutase 1 [Prunus persica] Back     alignment and taxonomy information
>gi|351726054|ref|NP_001235066.1| MnSOD [Glycine max] gi|356516259|ref|XP_003526813.1| PREDICTED: superoxide dismutase [Mn], mitochondrial-like [Glycine max] gi|147945633|gb|ABQ52658.1| MnSOD [Glycine max] Back     alignment and taxonomy information
>gi|134672|sp|P11796.1|SODM_NICPL RecName: Full=Superoxide dismutase [Mn], mitochondrial; Flags: Precursor gi|19693|emb|CAA32643.1| unnamed protein product [Nicotiana plumbaginifolia] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query139
UNIPROTKB|Q9SM64228 SOD "Superoxide dismutase [Mn] 0.956 0.583 0.864 1.2e-63
UNIPROTKB|P11796228 SODA "Superoxide dismutase [Mn 0.956 0.583 0.849 1.6e-63
TAIR|locus:2085552231 MSD1 "manganese superoxide dis 0.942 0.567 0.809 2.5e-58
TAIR|locus:2078356241 AT3G56350 [Arabidopsis thalian 0.935 0.539 0.792 1.6e-56
DICTYBASE|DDB_G0271106226 sod2 "putative mitochondrial s 0.906 0.557 0.601 3.7e-39
ZFIN|ZDB-GENE-030131-7742224 sod2 "superoxide dismutase 2, 0.892 0.553 0.576 9.2e-36
RGD|3732222 Sod2 "superoxide dismutase 2, 0.884 0.554 0.581 2.4e-35
UNIPROTKB|F1SB60222 SOD2 "Superoxide dismutase [Mn 0.884 0.554 0.581 3.1e-35
MGI|MGI:98352222 Sod2 "superoxide dismutase 2, 0.884 0.554 0.565 6.5e-35
UNIPROTKB|Q9XS41222 SOD2 "Superoxide dismutase [Mn 0.884 0.554 0.565 1.1e-34
UNIPROTKB|Q9SM64 SOD "Superoxide dismutase [Mn], mitochondrial" [Prunus persica (taxid:3760)] Back     alignment and assigned GO terms
 Score = 649 (233.5 bits), Expect = 1.2e-63, P = 1.2e-63
 Identities = 115/133 (86%), Positives = 124/133 (93%)

Query:     7 GHVNHSIFWKNLAPVHEGGGEPPHSSLGWAIDTHFGSLEALIQKMSAEGAALQGSGWVWL 66
             GH+NHSIFWKNLAPV EGGGEPP  SLGWAIDT+FGSLEAL+QKM+AEGAALQGSGWVWL
Sbjct:    96 GHINHSIFWKNLAPVREGGGEPPKGSLGWAIDTNFGSLEALVQKMNAEGAALQGSGWVWL 155

Query:    67 GLDTEFKRLVVETTANQDPLVTKAPTLVPLLGIDVWEHAYYLQYKNVKPDYLKNIWNVMN 126
              LD E K+LVVETTANQDPLVTK PTLVPLLGIDVWEHAYYLQYKNV+PDYLKNIW V+N
Sbjct:   156 ALDKELKKLVVETTANQDPLVTKGPTLVPLLGIDVWEHAYYLQYKNVRPDYLKNIWKVIN 215

Query:   127 WKYASDVYQKECP 139
             WKYAS+VY+KE P
Sbjct:   216 WKYASEVYEKESP 228
GO:0004784 "superoxide dismutase activity" evidence=NAS
GO:0005759 "mitochondrial matrix" evidence=ISS
GO:0019430 "removal of superoxide radicals" evidence=NAS
UNIPROTKB|P11796 SODA "Superoxide dismutase [Mn], mitochondrial" [Nicotiana plumbaginifolia (taxid:4092)] Back     alignment and assigned GO terms
TAIR|locus:2085552 MSD1 "manganese superoxide dismutase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2078356 AT3G56350 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0271106 sod2 "putative mitochondrial superoxide dismutase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-7742 sod2 "superoxide dismutase 2, mitochondrial" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
RGD|3732 Sod2 "superoxide dismutase 2, mitochondrial" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1SB60 SOD2 "Superoxide dismutase [Mn], mitochondrial" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:98352 Sod2 "superoxide dismutase 2, mitochondrial" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q9XS41 SOD2 "Superoxide dismutase [Mn], mitochondrial" [Equus caballus (taxid:9796)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P41982SODM_RABIT1, ., 1, 5, ., 1, ., 10.53480.89920.6188yesno
Q43008SODM_ORYSJ1, ., 1, 5, ., 1, ., 10.79840.92800.5584yesno
O81235SODM1_ARATH1, ., 1, 5, ., 1, ., 10.80300.94960.5714yesno
Q8HXP7SODM_PANTR1, ., 1, 5, ., 1, ., 10.55030.89920.6313yesno
Q8HXP2SODM_MACMU1, ., 1, 5, ., 1, ., 10.55810.89920.6313yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer1.15.1.10.946
3rd Layer1.15.10.963

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
MnSOD
RecName- Full=Superoxide dismutase; EC=1.15.1.1;; Destroys radicals which are normally produced within the cells and which are toxic to biological systems (By similarity) (228 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00002880001
RecName- Full=Catalase; EC=1.11.1.6;; Occurs in almost all aerobically respiring organisms and [...] (489 aa)
     •• 0.844
GCat
RecName- Full=Catalase; EC=1.11.1.6;; Occurs in almost all aerobically respiring organisms and [...] (514 aa)
   • •• 0.843
GSVIVG00011743001
similar to catalase; Occurs in almost all aerobically respiring organisms and serves to protect [...] (943 aa)
   • •• 0.829
GSVIVG00021525001
SubName- Full=Chromosome chr8 scaffold_23, whole genome shotgun sequence; (273 aa)
•  • •• 0.796
GSVIVG00000409001
RecName- Full=Glutathione peroxidase; (168 aa)
      • 0.721
GSVIVG00001920001
RecName- Full=Glutathione peroxidase; (167 aa)
      • 0.720
GSVIVG00000410001
RecName- Full=Glutathione peroxidase; (170 aa)
      • 0.714
GSVIVG00035063001
SubName- Full=Chromosome chr1 scaffold_75, whole genome shotgun sequence; (127 aa)
      • 0.708
GSVIVG00023686001
RecName- Full=Glutathione peroxidase; (170 aa)
      • 0.702
GSVIVG00028048001
SubName- Full=Chromosome chr7 scaffold_42, whole genome shotgun sequence; (470 aa)
•  •• • 0.675

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query139
PLN02471231 PLN02471, PLN02471, superoxide dismutase [Mn] 7e-96
COG0605204 COG0605, SodA, Superoxide dismutase [Inorganic ion 1e-51
pfam02777106 pfam02777, Sod_Fe_C, Iron/manganese superoxide dis 2e-48
PRK10925206 PRK10925, PRK10925, superoxide dismutase; Provisio 1e-32
PRK10543193 PRK10543, PRK10543, superoxide dismutase; Provisio 4e-26
PTZ00078193 PTZ00078, PTZ00078, Superoxide dismutase [Fe]; Pro 3e-24
PLN02622261 PLN02622, PLN02622, iron superoxide dismutase 2e-21
PLN02685299 PLN02685, PLN02685, iron superoxide dismutase 3e-20
PLN02184212 PLN02184, PLN02184, superoxide dismutase [Fe] 8e-20
>gnl|CDD|215262 PLN02471, PLN02471, superoxide dismutase [Mn] Back     alignment and domain information 
 Score =  275 bits (704), Expect = 7e-96
 Identities = 117/133 (87%), Positives = 125/133 (93%)

Query: 7   GHVNHSIFWKNLAPVHEGGGEPPHSSLGWAIDTHFGSLEALIQKMSAEGAALQGSGWVWL 66
           GHVNHSIFWKNLAPV EGGGEPPH SLGWAID HFGSLEAL++KMSAEGAA+QGSGWVWL
Sbjct: 99  GHVNHSIFWKNLAPVSEGGGEPPHGSLGWAIDEHFGSLEALVKKMSAEGAAVQGSGWVWL 158

Query: 67  GLDTEFKRLVVETTANQDPLVTKAPTLVPLLGIDVWEHAYYLQYKNVKPDYLKNIWNVMN 126
           GLD E K+LVVETTANQDPLVTK P+LVPLLGIDVWEHAYYLQYKNV+PDYLKNIW VMN
Sbjct: 159 GLDKELKKLVVETTANQDPLVTKGPSLVPLLGIDVWEHAYYLQYKNVRPDYLKNIWKVMN 218

Query: 127 WKYASDVYQKECP 139
           WKYAS+VY+KEC 
Sbjct: 219 WKYASEVYEKECN 231

Length = 231
>gnl|CDD|223678 COG0605, SodA, Superoxide dismutase [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|202388 pfam02777, Sod_Fe_C, Iron/manganese superoxide dismutases, C-terminal domain Back     alignment and domain information
>gnl|CDD|182843 PRK10925, PRK10925, superoxide dismutase; Provisional Back     alignment and domain information
>gnl|CDD|182534 PRK10543, PRK10543, superoxide dismutase; Provisional Back     alignment and domain information
>gnl|CDD|185432 PTZ00078, PTZ00078, Superoxide dismutase [Fe]; Provisional Back     alignment and domain information
>gnl|CDD|166263 PLN02622, PLN02622, iron superoxide dismutase Back     alignment and domain information
>gnl|CDD|215369 PLN02685, PLN02685, iron superoxide dismutase Back     alignment and domain information
>gnl|CDD|177838 PLN02184, PLN02184, superoxide dismutase [Fe] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 139
COG0605204 SodA Superoxide dismutase [Inorganic ion transport 100.0
PLN02471231 superoxide dismutase [Mn] 100.0
PRK10543193 superoxide dismutase; Provisional 100.0
PTZ00078193 Superoxide dismutase [Fe]; Provisional 100.0
PLN02184212 superoxide dismutase [Fe] 100.0
PLN02622261 iron superoxide dismutase 100.0
PRK10925206 superoxide dismutase; Provisional 100.0
KOG0876234 consensus Manganese superoxide dismutase [Inorgani 100.0
PLN02685299 iron superoxide dismutase 100.0
PF02777106 Sod_Fe_C: Iron/manganese superoxide dismutases, C- 100.0
>COG0605 SodA Superoxide dismutase [Inorganic ion transport and metabolism] Back     alignment and domain information 
Probab=100.00  E-value=7e-61  Score=372.39  Aligned_cols=133  Identities=44%  Similarity=0.881  Sum_probs=125.3

Q ss_pred             CccchHHHHhHHHHhhccCCCCCCCCCCCchhHHHHHHhhcCCHHHHHHHHHHHhhcCccCceEEEEEeCCCCeeEEEEe
Q 032513            1 MVICHAGHVNHSIFWKNLAPVHEGGGEPPHSSLGWAIDTHFGSLEALIQKMSAEGAALQGSGWVWLGLDTEFKRLVVETT   80 (139)
Q Consensus         1 ~~fn~~g~~NH~~f~~~l~p~~~~~~~~p~~~L~~~I~~~FGS~d~fk~~f~~~a~~~~GsGW~wLv~d~~~~~L~i~~t   80 (139)
                      |.||+|||+||+|||++|+|.  ++++.|+|.|+++|+++|||+|+||++|+++|.++|||||+|||+|+. ++|.|++|
T Consensus        70 ~~nn~~gh~NH~~fw~~l~p~--~gg~~p~g~L~~aI~~~FGS~d~fk~~f~~aa~~~fGsGWawLv~~~~-~kL~i~~t  146 (204)
T COG0605          70 LFNNAGGHWNHSLFWENLSPG--GGGGKPTGELAAAINKDFGSFDKFKEEFTAAAASVFGSGWAWLVYDPD-GKLEIVST  146 (204)
T ss_pred             HHhcchhhhhHHHHHhhcCCC--CCCCCCCHHHHHHHHHHhcCHHHHHHHHHHHHhhCCCCceEEEEECCC-CcEEEEec
Confidence            478999999999999999994  366789999999999999999999999999999999999999999986 69999999


Q ss_pred             cCCCccccCCCCCceEEEeccCchhhHhhhcCChHHHHHHHhhcCCHHHHHHHHHhhC
Q 032513           81 ANQDPLVTKAPTLVPLLGIDVWEHAYYLQYKNVKPDYLKNIWNVMNWKYASDVYQKEC  138 (139)
Q Consensus        81 ~n~~p~~~~g~~~~PlL~iDvwEHAYy~dY~n~r~~Yi~~~w~~inW~~v~~r~~~~~  138 (139)
                      +||+.+.+.+  .+|||||||||||||+||+|+|++||++||++|||++|++||++++
T Consensus       147 ~n~~~p~~~~--~~PiL~lDvWEHAYYldY~N~R~~Yv~afwnvVNW~~V~~r~~~a~  202 (204)
T COG0605         147 YNQDTPLMWG--SVPLLGLDVWEHAYYLDYGNRRPDYVEAFWNVVNWDEVEERFEAAK  202 (204)
T ss_pred             cCCCCcccCC--CCceEEecchHHHHHHHhccCcHHHHHHHHHhcCHHHHHHHHHHHH
Confidence            9998776666  7999999999999999999999999999999999999999999875

>PLN02471 superoxide dismutase [Mn] Back     alignment and domain information
>PRK10543 superoxide dismutase; Provisional Back     alignment and domain information
>PTZ00078 Superoxide dismutase [Fe]; Provisional Back     alignment and domain information
>PLN02184 superoxide dismutase [Fe] Back     alignment and domain information
>PLN02622 iron superoxide dismutase Back     alignment and domain information
>PRK10925 superoxide dismutase; Provisional Back     alignment and domain information
>KOG0876 consensus Manganese superoxide dismutase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PLN02685 iron superoxide dismutase Back     alignment and domain information
>PF02777 Sod_Fe_C: Iron/manganese superoxide dismutases, C-terminal domain Note: SCOP classifies the two domains separately Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query139
1n0n_A199 Catalytic And Structural Effects Of Amino-Acid Subs 9e-35
1zsp_A198 Contribution To Structure And Catalysis Of Tyrosine 9e-35
2gds_A198 Interrupting The Hydrogen Bonding Network At The Ac 9e-35
1zuq_A198 Contribution To Structure And Catalysis Of Tyrosine 9e-35
1n0j_A199 The Structure Of Human Mitochondrial Mn3+ Superoxid 1e-34
1msd_A198 Comparison Of The Crystal Structures Of Genetically 1e-34
1luw_A198 Catalytic And Structural Effects Of Amino-Acid Subs 1e-34
1ap5_A198 Tyr34->phe Mutant Of Human Mitochondrial Manganese 1e-34
2p4k_A198 Contribution To Structure And Catalysis Of Tyrosine 1e-34
1zte_A198 Contribution To Structure And Catalysis Of Tyrosine 1e-34
2adp_A198 Nitrated Human Manganese Superoxide Dismutase Lengt 1e-34
2qkc_A196 Structural And Kinetic Study Of The Differences Bet 1e-34
1var_A198 Mitochondrial Manganese Superoxide Dismutase Varian 1e-34
2qka_A196 Structural And Kinetic Study Of The Differences Bet 1e-34
1pm9_A198 Crystal Structure Of Human Mnsod H30n, Y166f Mutant 2e-34
1pl4_A198 Crystal Structure Of Human Mnsod Y166f Mutant Lengt 2e-34
3c3t_A198 Role Of A Glutamate Bridge Spanning The Dimeric Int 3e-34
1qnm_A198 Human Manganese Superoxide Dismutase Mutant Q143n L 5e-34
1szx_A198 Role Of Hydrogen Bonding In The Active Site Of Huma 5e-34
3c3s_A198 Role Of A Glutamate Bridge Spanning The Dimeric Int 5e-34
1em1_A198 X-Ray Crystal Structure For Human Manganese Superox 6e-34
3dc6_A198 Crystal Structure Of A Manganese Superoxide Dismuta 8e-34
1ja8_A198 Kinetic Analysis Of Product Inhibition In Human Man 1e-33
3qvn_A206 Crystal Structure Of Cytosolic Mnsod3 From Candida 3e-31
3dc5_A195 Crystal Structure Of A Manganese Superoxide Dismuta 6e-31
3rn4_A215 Crystal Structure Of Iron-Substituted Sod2 From Sac 6e-31
3bfr_A215 The Crystal Structure Of Sod2 From Saccharomyces Ce 8e-31
1xil_A198 Hydrogen Bonding In Human Manganese Superoxide Dism 1e-30
1xdc_A198 Hydrogen Bonding In Human Manganese Superoxide Dism 1e-30
4e4e_A207 Crystal Structure Of The Y34f Mutant Of Saccharomyc 3e-28
3lsu_A207 Crystal Structure Of Sod2 From Saccharomyces Cerevi 3e-28
3mds_A203 Maganese Superoxide Dismutase From Thermus Thermoph 7e-28
1kkc_A221 Crystal Structure Of Aspergillus Fumigatus Mnsod Le 2e-26
1xuq_A212 Crystal Structure Of Soda-1 (Ba4499) From Bacillus 5e-26
1gn3_A207 H145q Mutant Of Mycobacterium Tuberculosis Iron-Sup 4e-25
1ar4_A201 X-Ray Structure Analysis Of The Cambialistic Supero 5e-25
1gn6_A207 G152a Mutant Of Mycobacterium Tuberculosis Iron-Sup 1e-24
1gn4_A207 H145e Mutant Of Mycobacterium Tuberculosis Iron-Sup 1e-24
1ids_A207 X-Ray Structure Analysis Of The Iron-Dependent Supe 2e-24
2cdy_A231 Manganese Superoxide Dismutase (Mn-Sod) From Deinoc 3e-24
1y67_A229 Crystal Structure Of Manganese Superoxide Dismutase 3e-24
3kky_A211 Structure Of Manganese Superoxide Dismutase From De 3e-24
1gn2_A207 S123c Mutant Of The Iron-Superoxide Dismutase From 6e-24
2rcv_A202 Crystal Structure Of The Bacillus Subtilis Superoxi 8e-24
1i08_A205 Crystal Structure Analysis Of The H30a Mutant Of Ma 1e-23
1gv3_A248 The 2.0 Angstrom Resolution Structure Of The Cataly 1e-23
1en5_A205 Crystal Structure Analysis Of The E. Coli Manganese 1e-23
1vew_A205 Manganese Superoxide Dismutase From Escherichia Col 1e-23
4f2n_A230 Crystal Structure Of Iron Superoxide Dismutase From 1e-23
1i0h_A205 Crystal Structure Of The E. Coli Manganese Superoxi 3e-23
1en4_A205 Crystal Structure Analysis Of The E. Coli Manganese 7e-23
1qnn_A191 Cambialistic Superoxide Dismutase From Porphyromona 1e-22
1en6_A205 Crystal Structure Analysis Of The E. Coli Manganese 1e-22
1ues_A191 Crystal Structure Of Porphyromonas Gingivalis Sod L 9e-22
3esf_A197 Crystal Structure Of The Enzyme Fe-Superoxide Dismu 1e-21
1ma1_A205 Structure And Properties Of The Atypical Iron Super 1e-21
1xre_A217 Crystal Structure Of Soda-2 (Ba5696) From Bacillus 4e-21
2cw2_A226 Crystal Structure Of Superoxide Dismutase From P. M 5e-21
3tjt_A208 Crystal Structure Analysis Of The Superoxide Dismut 9e-21
1jr9_A202 Crystal Structure Of Manganese Superoxide Dismutase 2e-20
1za5_A192 Q69h-Fesod Length = 192 2e-20
4h3e_A241 Crystal Structure Of A Putative Iron Superoxide Dis 2e-20
1isa_A192 Structure-Function In E. Coli Iron Superoxide Dismu 1e-19
3tqj_A210 Structure Of The Superoxide Dismutase (Fe) (Sodb) F 1e-19
2nyb_A192 Crystal Structure Of E.Coli Iron Superoxide Dismuta 1e-19
3lio_A192 X-Ray Structure Of The Iron Superoxide Dismutase Fr 1e-19
3h1s_A195 Crystal Structure Of Superoxide Dismutase From Fran 2e-19
2awp_A198 Crystal Structure Of Plasmodium Knowlesi Structure 3e-19
1my6_A199 The 1.6 A Structure Of Fe-superoxide Dismutase From 5e-19
2gpc_A194 The Crystal Structure Of The Enzyme Fe-Superoxide D 6e-19
2goj_A197 The Crystal Structure Of The Enzyme Fe-Superoxide D 8e-19
2bpi_A206 Stucture Of Iron Dependent Superoxide Dismutase Fro 8e-19
3js4_A227 Crystal Structure Of Iron Superoxide Dismutase From 2e-18
2a03_A206 Superoxide Dismutase Protein From Plasmodium Berghe 3e-18
3ak1_A214 Superoxide Dismutase From Aeropyrum Pernix K1, Apo- 8e-18
1dt0_A197 Cloning, Sequence, And Crystallographic Structure O 1e-17
3sdp_A195 The 2.1 Angstroms Resolution Structure Of Iron Supe 2e-17
3cei_A213 Crystal Structure Of Superoxide Dismutase From Heli 3e-17
2w7w_A194 The Crystal Structure Of Iron Superoxide Dismutase 5e-17
2cw3_A280 X-Ray Structure Of Pmsod2, Superoxide Dismutase Fro 1e-16
1b06_A210 Superoxide Dismutase From Sulfolobus Acidocaldarius 6e-15
3evk_A222 Crystal Structure Of The Metal-Bound Superoxide Dis 1e-14
1wb7_A210 Iron Superoxide Dismutase (Fe-Sod) From The Hyperth 1e-14
1wb8_A210 Iron Superoxide Dismutase (Fe-Sod) From The Hyperth 1e-14
1coj_A212 Fe-Sod From Aquifex Pyrophilus, A Hyperthermophilic 2e-14
1p7g_A222 Crystal Structure Of Superoxide Dismutase From Pyro 3e-14
4ffk_A223 X-Ray Structure Of Iron Superoxide Dismutase From A 2e-13
1unf_X238 The Crystal Structure Of The Eukaryotic Fesod From 1e-11
>pdb|1N0N|A Chain A, Catalytic And Structural Effects Of Amino-Acid Substitution At His30 In Human Manganese Superoxide Dismutase Length = 199 Back     alignment and structure 
Iteration: 1

 Score =  142 bits (357), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 86/129 (66%), Gaps = 4/129 (3%)
Query: 6   AGHVNHSIFWKNLAPVHEGGGEPPHSSLGWAIDTHFGSLEALIQKMSAEGAALQGSGWVW 65
            GH+NHSIFW NL+P   GGGEP    L  AI   FGS +   +K++A    +QGSGW W
Sbjct: 70  GGHINHSIFWTNLSP--NGGGEPK-GELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGW 126
Query: 66  LGLDTEFKRLVVETTANQDPLVTKAPTLVPLLGIDVWEHAYYLQYKNVKPDYLKNIWNVM 125
           LG + E   L +    NQDPL      L+PLLGIDVWEHAYYLQYKNV+PDYLK IWNV+
Sbjct: 127 LGFNKERGHLQIAACPNQDPL-QGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVI 185
Query: 126 NWKYASDVY 134
           NW+  ++ Y
Sbjct: 186 NWENVTERY 194
>pdb|1ZSP|A Chain A, Contribution To Structure And Catalysis Of Tyrosine 34 In Human Manganese Superoxide Dismutase Length = 198 Back     alignment and structure
>pdb|2GDS|A Chain A, Interrupting The Hydrogen Bonding Network At The Active Site Of Human Manganese Superoxide Dismutase Length = 198 Back     alignment and structure
>pdb|1ZUQ|A Chain A, Contribution To Structure And Catalysis Of Tyrosine 34 In Human Manganese Superoxide Dismutase Length = 198 Back     alignment and structure
>pdb|1N0J|A Chain A, The Structure Of Human Mitochondrial Mn3+ Superoxide Dismutase Reveals A Novel Tetrameric Interface Of Two 4-Helix Bundles Length = 199 Back     alignment and structure
>pdb|1MSD|A Chain A, Comparison Of The Crystal Structures Of Genetically Engineered Human Manganese Superoxide Dismutase And Manganese Superoxide Dismutase From Thermus Thermophilus. Differences In Dimer-Dimer Interactions. Length = 198 Back     alignment and structure
>pdb|1LUW|A Chain A, Catalytic And Structural Effects Of Amino-Acid Substitution At His 30 In Human Manganese Superoxide Dismutase: Insertion Of Val Cgamma Into The Substrate Access Channel Length = 198 Back     alignment and structure
>pdb|1AP5|A Chain A, Tyr34->phe Mutant Of Human Mitochondrial Manganese Superoxide Dismutase Length = 198 Back     alignment and structure
>pdb|2P4K|A Chain A, Contribution To Structure And Catalysis Of Tyrosine 34 In Human Manganese Superoxide Dismutase Length = 198 Back     alignment and structure
>pdb|1ZTE|A Chain A, Contribution To Structure And Catalysis Of Tyrosine 34 In Human Manganese Suerpoxide Dismutase Length = 198 Back     alignment and structure
>pdb|2ADP|A Chain A, Nitrated Human Manganese Superoxide Dismutase Length = 198 Back     alignment and structure
>pdb|2QKC|A Chain A, Structural And Kinetic Study Of The Differences Between Human And E.Coli Manganese Superoxide Dismutases Length = 196 Back     alignment and structure
>pdb|1VAR|A Chain A, Mitochondrial Manganese Superoxide Dismutase Variant With Ile 58 Replaced By Thr Length = 198 Back     alignment and structure
>pdb|2QKA|A Chain A, Structural And Kinetic Study Of The Differences Between Human And E.Coli Manganese Superoxide Dismutases Length = 196 Back     alignment and structure
>pdb|1PM9|A Chain A, Crystal Structure Of Human Mnsod H30n, Y166f Mutant Length = 198 Back     alignment and structure
>pdb|1PL4|A Chain A, Crystal Structure Of Human Mnsod Y166f Mutant Length = 198 Back     alignment and structure
>pdb|3C3T|A Chain A, Role Of A Glutamate Bridge Spanning The Dimeric Interface Of Human Manganese Superoxide Dismutase Length = 198 Back     alignment and structure
>pdb|1QNM|A Chain A, Human Manganese Superoxide Dismutase Mutant Q143n Length = 198 Back     alignment and structure
>pdb|1SZX|A Chain A, Role Of Hydrogen Bonding In The Active Site Of Human Manganese Superoxide Dismutase Length = 198 Back     alignment and structure
>pdb|3C3S|A Chain A, Role Of A Glutamate Bridge Spanning The Dimeric Interface Of Human Manganese Superoxide Dismutase Length = 198 Back     alignment and structure
>pdb|1EM1|A Chain A, X-Ray Crystal Structure For Human Manganese Superoxide Dismutase, Q143a Length = 198 Back     alignment and structure
>pdb|3DC6|A Chain A, Crystal Structure Of A Manganese Superoxide Dismutases From Caenorhabditis Elegans Length = 198 Back     alignment and structure
>pdb|1JA8|A Chain A, Kinetic Analysis Of Product Inhibition In Human Manganese Superoxide Dismutase Length = 198 Back     alignment and structure
>pdb|3QVN|A Chain A, Crystal Structure Of Cytosolic Mnsod3 From Candida Albicans Length = 206 Back     alignment and structure
>pdb|3DC5|A Chain A, Crystal Structure Of A Manganese Superoxide Dismutases From Caenorhabditis Elegans Length = 195 Back     alignment and structure
>pdb|3RN4|A Chain A, Crystal Structure Of Iron-Substituted Sod2 From Saccharomyces Cerevisiae Length = 215 Back     alignment and structure
>pdb|3BFR|A Chain A, The Crystal Structure Of Sod2 From Saccharomyces Cerevisiae Length = 215 Back     alignment and structure
>pdb|1XIL|A Chain A, Hydrogen Bonding In Human Manganese Superoxide Dismutase Containing 3- Fluorotyrosine Length = 198 Back     alignment and structure
>pdb|1XDC|A Chain A, Hydrogen Bonding In Human Manganese Superoxide Dismutase Containing 3- Fluorotyrosine Length = 198 Back     alignment and structure
>pdb|4E4E|A Chain A, Crystal Structure Of The Y34f Mutant Of Saccharomyces Cerevisiae Manganese Superoxide Dismutase Length = 207 Back     alignment and structure
>pdb|3LSU|A Chain A, Crystal Structure Of Sod2 From Saccharomyces Cerevisiae Length = 207 Back     alignment and structure
>pdb|3MDS|A Chain A, Maganese Superoxide Dismutase From Thermus Thermophilus Length = 203 Back     alignment and structure
>pdb|1KKC|A Chain A, Crystal Structure Of Aspergillus Fumigatus Mnsod Length = 221 Back     alignment and structure
>pdb|1XUQ|A Chain A, Crystal Structure Of Soda-1 (Ba4499) From Bacillus Anthracis At 1.8a Resolution. Length = 212 Back     alignment and structure
>pdb|1GN3|A Chain A, H145q Mutant Of Mycobacterium Tuberculosis Iron-Superoxide Dismutase. Length = 207 Back     alignment and structure
>pdb|1AR4|A Chain A, X-Ray Structure Analysis Of The Cambialistic Superoxide Dismutase From Propionibacterium Shermanii Active With Fe Or Mn Length = 201 Back     alignment and structure
>pdb|1GN6|A Chain A, G152a Mutant Of Mycobacterium Tuberculosis Iron-Superoxide Dismutase. Length = 207 Back     alignment and structure
>pdb|1GN4|A Chain A, H145e Mutant Of Mycobacterium Tuberculosis Iron-Superoxide Dismutase. Length = 207 Back     alignment and structure
>pdb|1IDS|A Chain A, X-Ray Structure Analysis Of The Iron-Dependent Superoxide Dismutase From Mycobacterium Tuberculosis At 2.0 Angstroms Resolutions Reveals Novel Dimer-Dimer Interactions Length = 207 Back     alignment and structure
>pdb|2CDY|A Chain A, Manganese Superoxide Dismutase (Mn-Sod) From Deinococcus Radiodurans Length = 231 Back     alignment and structure
>pdb|1Y67|A Chain A, Crystal Structure Of Manganese Superoxide Dismutase From Deinococcus Radiodurans Length = 229 Back     alignment and structure
>pdb|3KKY|A Chain A, Structure Of Manganese Superoxide Dismutase From Deinococcus Radiodurans In The Orthorhombic Space Group P212121: A Case Study Of Mistaken Identity Length = 211 Back     alignment and structure
>pdb|1GN2|A Chain A, S123c Mutant Of The Iron-Superoxide Dismutase From Mycobacterium Tuberculosis. Length = 207 Back     alignment and structure
>pdb|2RCV|A Chain A, Crystal Structure Of The Bacillus Subtilis Superoxide Dismutase Length = 202 Back     alignment and structure
>pdb|1I08|A Chain A, Crystal Structure Analysis Of The H30a Mutant Of Manganese Superoxide Dismutase From E. Coli Length = 205 Back     alignment and structure
>pdb|1GV3|A Chain A, The 2.0 Angstrom Resolution Structure Of The Catalytic Portion Of A Cyanobacterial Membrane-Bound Manganese Superoxide Dismutase Length = 248 Back     alignment and structure
>pdb|1EN5|A Chain A, Crystal Structure Analysis Of The E. Coli Manganese Superoxide Dismutase Y34f Mutant Length = 205 Back     alignment and structure
>pdb|1VEW|A Chain A, Manganese Superoxide Dismutase From Escherichia Coli Length = 205 Back     alignment and structure
>pdb|4F2N|A Chain A, Crystal Structure Of Iron Superoxide Dismutase From Leishmania Major Length = 230 Back     alignment and structure
>pdb|1I0H|A Chain A, Crystal Structure Of The E. Coli Manganese Superoxide Dismutase Mutant Y174f At 1.35 Angstroms Resolution. Length = 205 Back     alignment and structure
>pdb|1EN4|A Chain A, Crystal Structure Analysis Of The E. Coli Manganese Superoxide Dismutase Q146h Mutant Length = 205 Back     alignment and structure
>pdb|1QNN|A Chain A, Cambialistic Superoxide Dismutase From Porphyromonas Gingivalis Length = 191 Back     alignment and structure
>pdb|1EN6|A Chain A, Crystal Structure Analysis Of The E. Coli Manganese Superoxide Dismutase Q146l Mutant Length = 205 Back     alignment and structure
>pdb|1UES|A Chain A, Crystal Structure Of Porphyromonas Gingivalis Sod Length = 191 Back     alignment and structure
>pdb|3ESF|A Chain A, Crystal Structure Of The Enzyme Fe-Superoxide Dismutase Tbsodb2 From Trypanosoma Brucei Length = 197 Back     alignment and structure
>pdb|1MA1|A Chain A, Structure And Properties Of The Atypical Iron Superoxide Dismutase From Methanobacterium Thermoautotrophicum Length = 205 Back     alignment and structure
>pdb|1XRE|A Chain A, Crystal Structure Of Soda-2 (Ba5696) From Bacillus Anthracis At 1.8a Resolution. Length = 217 Back     alignment and structure
>pdb|2CW2|A Chain A, Crystal Structure Of Superoxide Dismutase From P. Marinus Length = 226 Back     alignment and structure
>pdb|3TJT|A Chain A, Crystal Structure Analysis Of The Superoxide Dismutase From Clostridium Difficile Length = 208 Back     alignment and structure
>pdb|1JR9|A Chain A, Crystal Structure Of Manganese Superoxide Dismutases From Bacillus Halodenitrificans Length = 202 Back     alignment and structure
>pdb|1ZA5|A Chain A, Q69h-Fesod Length = 192 Back     alignment and structure
>pdb|4H3E|A Chain A, Crystal Structure Of A Putative Iron Superoxide Dismutase From Trypanosoma Cruzi Bound To Iron Length = 241 Back     alignment and structure
>pdb|1ISA|A Chain A, Structure-Function In E. Coli Iron Superoxide Dismutase: Comparisons With The Manganese Enzyme From T. Thermophilus Length = 192 Back     alignment and structure
>pdb|3TQJ|A Chain A, Structure Of The Superoxide Dismutase (Fe) (Sodb) From Coxiella Burnetii Length = 210 Back     alignment and structure
>pdb|2NYB|A Chain A, Crystal Structure Of E.Coli Iron Superoxide Dismutase Q69e At 1.1 Angstrom Resolution Length = 192 Back     alignment and structure
>pdb|3LIO|A Chain A, X-Ray Structure Of The Iron Superoxide Dismutase From Pseudoalteromonas Haloplanktis (Crystal Form I) Length = 192 Back     alignment and structure
>pdb|3H1S|A Chain A, Crystal Structure Of Superoxide Dismutase From Francisella Tularensis Subsp. Tularensis Schu S4 Length = 195 Back     alignment and structure
>pdb|2AWP|A Chain A, Crystal Structure Of Plasmodium Knowlesi Structure Of Iron Super-Oxide Dismutase Length = 198 Back     alignment and structure
>pdb|1MY6|A Chain A, The 1.6 A Structure Of Fe-superoxide Dismutase From The Thermophilic Cyanobacterium Thermosynechococcus Elongatus : Correlation Of Epr And Structural Characteristics Length = 199 Back     alignment and structure
>pdb|2GPC|A Chain A, The Crystal Structure Of The Enzyme Fe-Superoxide Dismutase From Trypanosoma Cruzi Length = 194 Back     alignment and structure
>pdb|2GOJ|A Chain A, The Crystal Structure Of The Enzyme Fe-Superoxide Dismutase From Plasmodium Falciparum Length = 197 Back     alignment and structure
>pdb|2BPI|A Chain A, Stucture Of Iron Dependent Superoxide Dismutase From P. Falciparum. Length = 206 Back     alignment and structure
>pdb|3JS4|A Chain A, Crystal Structure Of Iron Superoxide Dismutase From Anaplasma Phagocytophilum Length = 227 Back     alignment and structure
>pdb|2A03|A Chain A, Superoxide Dismutase Protein From Plasmodium Berghei Length = 206 Back     alignment and structure
>pdb|3AK1|A Chain A, Superoxide Dismutase From Aeropyrum Pernix K1, Apo-Form Length = 214 Back     alignment and structure
>pdb|1DT0|A Chain A, Cloning, Sequence, And Crystallographic Structure Of Recombinant Iron Superoxide Dismutase From Pseudomonas Ovalis Length = 197 Back     alignment and structure
>pdb|3SDP|A Chain A, The 2.1 Angstroms Resolution Structure Of Iron Superoxide Dismutase From Pseudomonas Ovalis Length = 195 Back     alignment and structure
>pdb|3CEI|A Chain A, Crystal Structure Of Superoxide Dismutase From Helicobacter Pylori Length = 213 Back     alignment and structure
>pdb|2W7W|A Chain A, The Crystal Structure Of Iron Superoxide Dismutase From Aliivibrio Salmonicida. Length = 194 Back     alignment and structure
>pdb|2CW3|A Chain A, X-Ray Structure Of Pmsod2, Superoxide Dismutase From Perkinsus Marinus Length = 280 Back     alignment and structure
>pdb|1B06|A Chain A, Superoxide Dismutase From Sulfolobus Acidocaldarius Length = 210 Back     alignment and structure
>pdb|3EVK|A Chain A, Crystal Structure Of The Metal-Bound Superoxide Dismutase From Pyrobaculum Aerophilum Length = 222 Back     alignment and structure
>pdb|1WB7|A Chain A, Iron Superoxide Dismutase (Fe-Sod) From The Hyperthermophile Sulfolobus Solfataricus. Crystal Structure Of The Y41f Mutant. Length = 210 Back     alignment and structure
>pdb|1WB8|A Chain A, Iron Superoxide Dismutase (Fe-Sod) From The Hyperthermophile Sulfolobus Solfataricus. 2.3 A Resolution Structure Of Recombinant Protein With A Covalently Modified Tyrosin In The Active Site. Length = 210 Back     alignment and structure
>pdb|1COJ|A Chain A, Fe-Sod From Aquifex Pyrophilus, A Hyperthermophilic Bacterium Length = 212 Back     alignment and structure
>pdb|1P7G|A Chain A, Crystal Structure Of Superoxide Dismutase From Pyrobaculum Aerophilum Length = 222 Back     alignment and structure
>pdb|4FFK|A Chain A, X-Ray Structure Of Iron Superoxide Dismutase From Acidilobus Saccharovorans Length = 223 Back     alignment and structure
>pdb|1UNF|X Chain X, The Crystal Structure Of The Eukaryotic Fesod From Vigna Unguiculata Suggests A New Enzymatic Mechanism Length = 238 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query139
3rn4_A215 Superoxide dismutase [MN], mitochondrial; mitochon 4e-72
1b06_A210 Protein (superoxide dismutase); oxidoreductase; 2. 9e-72
1kkc_A221 Mnsod, manganese superoxide dismutase; homotetrame 1e-71
3ak2_A214 Superoxide dismutase [MN/FE]; cambialistic, oxidor 4e-71
1pl4_A198 Superoxide dismutase [MN], mitochondrial; oxidored 6e-71
1ma1_A205 Superoxide dismutase; metal specificity, azide inh 8e-71
4ffk_A223 Superoxide dismutase; oxidoreductase, superoxide a 2e-70
3qvn_A206 Manganese-containing superoxide dismutase; Mn supe 3e-70
1bsm_A201 Superoxide dismutase; oxidoreductase; 1.35A {Propi 3e-70
3dc5_A195 Superoxide dismutase [MN] 2; alpha hairpin N domai 6e-70
1ids_A207 Iron superoxide dismutase; 2.00A {Mycobacterium tu 1e-69
1mng_A203 Manganese superoxide dismutase; oxidoreductase(sup 8e-69
1coj_A212 Protein (superoxide dismutase); oxidoreductase; 1. 3e-67
1ix9_A205 Mnsod, superoxide dismutase; manganese superoxide 8e-64
1xre_A217 SODA-2, superoxide dismutase; spine, oxidoreductas 4e-62
1gv3_A248 Manganese superoxide dismutase; anabaena PCC 7120, 8e-59
2cw3_A280 Pmsod2, iron superoxide dismutase; oxidoreductase; 2e-57
2rcv_A202 Superoxide dismutase [MN]; bacillus subtilis,super 9e-57
3kky_A211 Mnsod, superoxide dismutase [MN]; manganese, ME bi 1e-56
2gpc_A194 Iron superoxide dismutase; alpha+beta structure, o 4e-55
4f2n_A230 Superoxide dismutase; ssgcid, NIH, niaid, SBRI, em 2e-54
2cw2_A226 Superoxide dismutase 1; SOD, oxidoreductase; 1.86A 1e-52
3js4_A227 Superoxide dismutase; niaid, ssgcid, seattle struc 5e-52
2awp_A198 Iron super-oxide dismutase; structural genomics, s 8e-52
3cei_A213 Superoxide dismutase; oxidoreductase; 2.40A {Helic 8e-52
1dt0_A197 Superoxide dismutase; pseudomonas ovalis, oxidored 4e-51
1uer_A191 SOD, superoxide dismutase; metal-specific, cambial 1e-50
3lio_A192 Iron superoxide dismutase; cold adaptation, flexib 1e-49
2nyb_A192 Superoxide dismutase [FE]; iron superoxide dismuta 6e-49
3h1s_A195 Superoxide dismutase; SOBD, csgid, oxidoreductase, 3e-48
3tqj_A210 Superoxide dismutase [FE]; oxidoreductase; 2.00A { 5e-48
1my6_A199 Iron (III) superoxide dismutase; iron speroxide di 7e-46
1unf_X238 Iron superoxide dismutase; oxidoreductase, eukaryo 1e-44
>3rn4_A Superoxide dismutase [MN], mitochondrial; mitochondrial manganese superoxide dismutase, iron-binding, mitochondrion, oxidoreductase; 1.79A {Saccharomyces cerevisiae} PDB: 3bfr_A 3lsu_A* Length = 215 Back     alignment and structure
 Score =  213 bits (546), Expect = 4e-72
 Identities = 66/132 (50%), Positives = 85/132 (64%), Gaps = 4/132 (3%)

Query: 6   AGHVNHSIFWKNLAPVHEGGGEPPHSSLGWAIDTHFGSLEALIQKMSAEGAALQGSGWVW 65
            G  NH +FW+NLAP  +GGGEPP  +L  AID  FGSL+ LI+  + + A +QGSGW +
Sbjct: 84  GGFTNHCLFWENLAPESQGGGEPPTGALAKAIDEQFGSLDELIKLTNTKLAGVQGSGWAF 143

Query: 66  LGLD-TEFKRLVVETTANQDPLVTKAPTLVPLLGIDVWEHAYYLQYKNVKPDYLKNIWNV 124
           +  + +   +L V  T NQD +      LVPL+ ID WEHAYYLQY+N K DY K IWNV
Sbjct: 144 IVKNLSNGGKLDVVQTYNQDTVTGP---LVPLVAIDAWEHAYYLQYQNKKADYFKAIWNV 200

Query: 125 MNWKYASDVYQK 136
           +NWK AS  +  
Sbjct: 201 VNWKEASRRFDA 212
>1b06_A Protein (superoxide dismutase); oxidoreductase; 2.20A {Sulfolobus acidocaldarius} SCOP: a.2.11.1 d.44.1.1 PDB: 1wb8_A* 1wb7_A Length = 210 Back     alignment and structure
>1kkc_A Mnsod, manganese superoxide dismutase; homotetramer, oxidoreductase; 2.00A {Aspergillus fumigatus} SCOP: a.2.11.1 d.44.1.1 Length = 221 Back     alignment and structure
>3ak2_A Superoxide dismutase [MN/FE]; cambialistic, oxidoreductase; 1.35A {Aeropyrum pernix} PDB: 3ak1_A 3ak3_A 1p7g_A 3evk_A Length = 214 Back     alignment and structure
>1pl4_A Superoxide dismutase [MN], mitochondrial; oxidoreductase; 1.47A {Homo sapiens} SCOP: a.2.11.1 d.44.1.1 PDB: 1n0j_A 1luv_A 1msd_A 2adq_B 1pm9_A 3c3t_A 1ap6_A 1ap5_A 1var_A 3c3s_A 1em1_A 1qnm_A 1zte_A 1luw_A 2gds_A 1zuq_A 2adp_A* 1zsp_A 1n0n_A 2p4k_A ... Length = 198 Back     alignment and structure
>1ma1_A Superoxide dismutase; metal specificity, azide inhibition, peroxide inactivation, oxidoreductase; 2.60A {Methanothermobacterthermautotrophicus} SCOP: a.2.11.1 d.44.1.1 Length = 205 Back     alignment and structure
>4ffk_A Superoxide dismutase; oxidoreductase, superoxide acceptor; 1.76A {Acidilobus saccharovorans} Length = 223 Back     alignment and structure
>3qvn_A Manganese-containing superoxide dismutase; Mn superoxide dismutase, oxidoreductase; 2.60A {Candida albicans} Length = 206 Back     alignment and structure
>1bsm_A Superoxide dismutase; oxidoreductase; 1.35A {Propionibacterium freudenreichii subspshermanii} SCOP: a.2.11.1 d.44.1.1 PDB: 1ar4_A 1ar5_A 1bs3_A 1avm_A 1bt8_A Length = 201 Back     alignment and structure
>3dc5_A Superoxide dismutase [MN] 2; alpha hairpin N domain, alpha/beta C domain, oxidoreductase, manganese, metal-binding, mitochondrion; 1.70A {Caenorhabditis elegans} PDB: 3dc6_A Length = 195 Back     alignment and structure
>1ids_A Iron superoxide dismutase; 2.00A {Mycobacterium tuberculosis} SCOP: a.2.11.1 d.44.1.1 PDB: 1gn2_A 1gn3_A 1gn6_A 1gn4_A Length = 207 Back     alignment and structure
>1mng_A Manganese superoxide dismutase; oxidoreductase(superoxide acceptor); 1.80A {Thermus thermophilus} SCOP: a.2.11.1 d.44.1.1 PDB: 3mds_A Length = 203 Back     alignment and structure
>1coj_A Protein (superoxide dismutase); oxidoreductase; 1.90A {Aquifex pyrophilus} SCOP: a.2.11.1 d.44.1.1 Length = 212 Back     alignment and structure
>1ix9_A Mnsod, superoxide dismutase; manganese superoxide dismutase, Y174F mutant, hydrogen bond, reactivity, ultra-high resolution, oxidoreductase; 0.90A {Escherichia coli} SCOP: a.2.11.1 d.44.1.1 PDB: 1i0h_A 1ixb_A 1zlz_A 1d5n_A 1mmm_A 1vew_A 3k9s_A 3ot7_A 1en5_A 1en4_A 1i08_A 1en6_A Length = 205 Back     alignment and structure
>1xre_A SODA-2, superoxide dismutase; spine, oxidoreductase; 1.80A {Bacillus anthracis} Length = 217 Back     alignment and structure
>1gv3_A Manganese superoxide dismutase; anabaena PCC 7120,; 2.0A {Anabaena SP} SCOP: a.2.11.1 d.44.1.1 Length = 248 Back     alignment and structure
>2cw3_A Pmsod2, iron superoxide dismutase; oxidoreductase; 2.50A {Perkinsus marinus} Length = 280 Back     alignment and structure
>2rcv_A Superoxide dismutase [MN]; bacillus subtilis,superoxide dismutase, manganese, metal- binding, oxidoreductase, phosphorylation; 1.60A {Bacillus subtilis} PDB: 1xuq_A 1jr9_A Length = 202 Back     alignment and structure
>3kky_A Mnsod, superoxide dismutase [MN]; manganese, ME binding, oxidoreductase, metal binding protein; 1.80A {Deinococcus radiodurans} PDB: 2cdy_A 2ce4_A 1y67_A 2aw9_A Length = 211 Back     alignment and structure
>2gpc_A Iron superoxide dismutase; alpha+beta structure, oxidoreductase; 1.90A {Trypanosoma cruzi} PDB: 3esf_A Length = 194 Back     alignment and structure
>4f2n_A Superoxide dismutase; ssgcid, NIH, niaid, SBRI, emerald biostructures, structural national institute of allergy and infectious diseases; 1.85A {Leishmania major} Length = 230 Back     alignment and structure
>2cw2_A Superoxide dismutase 1; SOD, oxidoreductase; 1.86A {Perkinsus marinus} Length = 226 Back     alignment and structure
>3js4_A Superoxide dismutase; niaid, ssgcid, seattle structural genomics center for infect disease, GRAM-negative bacteria; 1.95A {Anaplasma phagocytophilum} Length = 227 Back     alignment and structure
>2awp_A Iron super-oxide dismutase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.00A {Plasmodium knowlesi} PDB: 2bpi_A 2a03_A 2goj_A Length = 198 Back     alignment and structure
>3cei_A Superoxide dismutase; oxidoreductase; 2.40A {Helicobacter pylori} Length = 213 Back     alignment and structure
>1dt0_A Superoxide dismutase; pseudomonas ovalis, oxidoreductase; 2.10A {Pseudomonas putida} SCOP: a.2.11.1 d.44.1.1 Length = 197 Back     alignment and structure
>1uer_A SOD, superoxide dismutase; metal-specific, cambialistic, oxidoreductase; 1.60A {Porphyromonas gingivalis} SCOP: a.2.11.1 d.44.1.1 PDB: 1qnn_A 1ues_A Length = 191 Back     alignment and structure
>3lio_A Iron superoxide dismutase; cold adaptation, flexibility, thermal stability, psychrophilic protein, metal-binding, oxidoreduc; HET: TRE; 1.50A {Pseudoalteromonas haloplanktis} PDB: 3lj9_A* 3ljf_A* 3sdp_A Length = 192 Back     alignment and structure
>2nyb_A Superoxide dismutase [FE]; iron superoxide dismutase Q69E, fesod, oxidoreductase; 1.10A {Escherichia coli} SCOP: a.2.11.1 d.44.1.1 PDB: 2bkb_A 1isa_A 1isb_A 1isc_A 1za5_A 2w7w_A Length = 192 Back     alignment and structure
>3h1s_A Superoxide dismutase; SOBD, csgid, oxidoreductase, structura genomics; 1.90A {Francisella tularensis subsp} Length = 195 Back     alignment and structure
>3tqj_A Superoxide dismutase [FE]; oxidoreductase; 2.00A {Coxiella burnetii} Length = 210 Back     alignment and structure
>1my6_A Iron (III) superoxide dismutase; iron speroxide dismutase, thermophIle, reactive oxygen species, cyanobacteria, SOD, fesod; 1.60A {Thermosynechococcus elongatus} SCOP: a.2.11.1 d.44.1.1 Length = 199 Back     alignment and structure
>1unf_X Iron superoxide dismutase; oxidoreductase, eukaryotic, metalloprotein; 1.97A {Vigna unguiculata} SCOP: a.2.11.1 d.44.1.1 Length = 238 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query139
1pl4_A198 Superoxide dismutase [MN], mitochondrial; oxidored 100.0
3rn4_A215 Superoxide dismutase [MN], mitochondrial; mitochon 100.0
1bsm_A201 Superoxide dismutase; oxidoreductase; 1.35A {Propi 100.0
1ids_A207 Iron superoxide dismutase; 2.00A {Mycobacterium tu 100.0
3dc5_A195 Superoxide dismutase [MN] 2; alpha hairpin N domai 100.0
1ma1_A205 Superoxide dismutase; metal specificity, azide inh 100.0
3qvn_A206 Manganese-containing superoxide dismutase; Mn supe 100.0
1b06_A210 Protein (superoxide dismutase); oxidoreductase; 2. 100.0
4ffk_A223 Superoxide dismutase; oxidoreductase, superoxide a 100.0
3ak2_A214 Superoxide dismutase [MN/FE]; cambialistic, oxidor 100.0
1mng_A203 Manganese superoxide dismutase; oxidoreductase(sup 100.0
2awp_A198 Iron super-oxide dismutase; structural genomics, s 100.0
3tqj_A210 Superoxide dismutase [FE]; oxidoreductase; 2.00A { 100.0
1xre_A217 SODA-2, superoxide dismutase; spine, oxidoreductas 100.0
3js4_A227 Superoxide dismutase; niaid, ssgcid, seattle struc 100.0
2nyb_A192 Superoxide dismutase [FE]; iron superoxide dismuta 100.0
3lio_A192 Iron superoxide dismutase; cold adaptation, flexib 100.0
1my6_A199 Iron (III) superoxide dismutase; iron speroxide di 100.0
2rcv_A202 Superoxide dismutase [MN]; bacillus subtilis,super 100.0
3cei_A213 Superoxide dismutase; oxidoreductase; 2.40A {Helic 100.0
1dt0_A197 Superoxide dismutase; pseudomonas ovalis, oxidored 100.0
1uer_A191 SOD, superoxide dismutase; metal-specific, cambial 100.0
4f2n_A230 Superoxide dismutase; ssgcid, NIH, niaid, SBRI, em 100.0
1gv3_A248 Manganese superoxide dismutase; anabaena PCC 7120, 100.0
1kkc_A221 Mnsod, manganese superoxide dismutase; homotetrame 100.0
3kky_A211 Mnsod, superoxide dismutase [MN]; manganese, ME bi 100.0
3tjt_A208 Superoxide dismutase; metal ION binding, rossmann 100.0
2cw2_A226 Superoxide dismutase 1; SOD, oxidoreductase; 1.86A 100.0
2gpc_A194 Iron superoxide dismutase; alpha+beta structure, o 100.0
3h1s_A195 Superoxide dismutase; SOBD, csgid, oxidoreductase, 100.0
1coj_A212 Protein (superoxide dismutase); oxidoreductase; 1. 100.0
1ix9_A205 Mnsod, superoxide dismutase; manganese superoxide 100.0
2cw3_A280 Pmsod2, iron superoxide dismutase; oxidoreductase; 100.0
4h3e_A241 Fesod, superoxide dismutase; structural genomics, 100.0
1unf_X238 Iron superoxide dismutase; oxidoreductase, eukaryo 100.0
2jb0_B131 Colicin E7; hydrolase/inhibitor, hydrolase/inhibit 87.04
1fr2_B134 Colicin E9; protein-protein complex, zinc containi 84.37
>1pl4_A Superoxide dismutase [MN], mitochondrial; oxidoreductase; 1.47A {Homo sapiens} SCOP: a.2.11.1 d.44.1.1 PDB: 1n0j_A 1luv_A 1msd_A 2adq_B 1pm9_A 3c3t_A 1ap6_A 1ap5_A 1var_A 3c3s_A 1em1_A 1qnm_A 1zte_A 1luw_A 2gds_A 1zuq_A 2adp_A* 1zsp_A 1n0n_A 2p4k_A ... Back     alignment and structure
Probab=100.00  E-value=1.9e-63  Score=385.48  Aligned_cols=132  Identities=52%  Similarity=0.990  Sum_probs=124.7

Q ss_pred             ccchHHHHhHHHHhhccCCCCCCCCCCCchhHHHHHHhhcCCHHHHHHHHHHHhhcCccCceEEEEEeCCCCeeEEEEec
Q 032513            2 VICHAGHVNHSIFWKNLAPVHEGGGEPPHSSLGWAIDTHFGSLEALIQKMSAEGAALQGSGWVWLGLDTEFKRLVVETTA   81 (139)
Q Consensus         2 ~fn~~g~~NH~~f~~~l~p~~~~~~~~p~~~L~~~I~~~FGS~d~fk~~f~~~a~~~~GsGW~wLv~d~~~~~L~i~~t~   81 (139)
                      .||+|||+||+|||+||+|   +++++|+|.|+++|+++|||+|+||++|+++|.++|||||+|||+|+.+|+|.|++|+
T Consensus        65 ~~n~ggh~NH~~fw~~L~P---~ggg~P~g~L~~aI~~~FGS~d~fk~~F~~aa~~~fGSGW~WLv~~~~~g~L~I~~t~  141 (198)
T 1pl4_A           65 KFNGGGHINHSIFWTNLSP---NGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACP  141 (198)
T ss_dssp             HHHHHHHHHHHHHHHTBCT---TCCSCCCHHHHHHHHHHHSSHHHHHHHHHHHHHTCCSSEEEEEEEETTTTEEEEEEEE
T ss_pred             HHHHHHHHhHHHHHHhcCC---CCCCCCCHHHHHHHHHHhCCHHHHHHHHHHHHhhCCCCcEEEEEEECCCCcEEEEecC
Confidence            6899999999999999999   4456799999999999999999999999999999999999999999878999999999


Q ss_pred             CCCcccc-CCCCCceEEEeccCchhhHhhhcCChHHHHHHHhhcCCHHHHHHHHHhhC
Q 032513           82 NQDPLVT-KAPTLVPLLGIDVWEHAYYLQYKNVKPDYLKNIWNVMNWKYASDVYQKEC  138 (139)
Q Consensus        82 n~~p~~~-~g~~~~PlL~iDvwEHAYy~dY~n~r~~Yi~~~w~~inW~~v~~r~~~~~  138 (139)
                      ||+|+.. .|  .+|||||||||||||+||+|+|++||++||++|||++|++||++++
T Consensus       142 n~dp~~~~~g--~~PlL~iDvWEHAYyldY~n~R~~Yv~~~w~~vnW~~v~~r~~~a~  197 (198)
T 1pl4_A          142 NQDPLQGTTG--LIPLLGIDVWEHAYFLQYKNVRPDYLKAIWNVINWENVTERYMACK  197 (198)
T ss_dssp             TTCCHHHHHC--CEEEEEEECSGGGTHHHHTTCHHHHHHHHGGGBCHHHHHHHHHHTT
T ss_pred             CCCCcccCCC--CEeEEEEecccchhHHHhccCHHHHHHHHHHhcCHHHHHHHHHHhh
Confidence            9998753 46  7999999999999999999999999999999999999999999876
>3rn4_A Superoxide dismutase [MN], mitochondrial; mitochondrial manganese superoxide dismutase, iron-binding, mitochondrion, oxidoreductase; 1.79A {Saccharomyces cerevisiae} PDB: 3bfr_A 3lsu_A* 4e4e_A* Back     alignment and structure
>1bsm_A Superoxide dismutase; oxidoreductase; 1.35A {Propionibacterium freudenreichii subspshermanii} SCOP: a.2.11.1 d.44.1.1 PDB: 1ar4_A 1ar5_A 1bs3_A 1avm_A 1bt8_A Back     alignment and structure
>1ids_A Iron superoxide dismutase; 2.00A {Mycobacterium tuberculosis} SCOP: a.2.11.1 d.44.1.1 PDB: 1gn2_A 1gn3_A 1gn6_A 1gn4_A Back     alignment and structure
>3dc5_A Superoxide dismutase [MN] 2; alpha hairpin N domain, alpha/beta C domain, oxidoreductase, manganese, metal-binding, mitochondrion; 1.70A {Caenorhabditis elegans} PDB: 3dc6_A Back     alignment and structure
>1ma1_A Superoxide dismutase; metal specificity, azide inhibition, peroxide inactivation, oxidoreductase; 2.60A {Methanothermobacterthermautotrophicus} SCOP: a.2.11.1 d.44.1.1 Back     alignment and structure
>3qvn_A Manganese-containing superoxide dismutase; Mn superoxide dismutase, oxidoreductase; 2.60A {Candida albicans} Back     alignment and structure
>1b06_A Protein (superoxide dismutase); oxidoreductase; 2.20A {Sulfolobus acidocaldarius} SCOP: a.2.11.1 d.44.1.1 PDB: 1wb8_A* 1wb7_A Back     alignment and structure
>4ffk_A Superoxide dismutase; oxidoreductase, superoxide acceptor; 1.76A {Acidilobus saccharovorans} Back     alignment and structure
>3ak2_A Superoxide dismutase [MN/FE]; cambialistic, oxidoreductase; 1.35A {Aeropyrum pernix} PDB: 3ak1_A 3ak3_A 1p7g_A 3evk_A Back     alignment and structure
>1mng_A Manganese superoxide dismutase; oxidoreductase(superoxide acceptor); 1.80A {Thermus thermophilus} SCOP: a.2.11.1 d.44.1.1 PDB: 3mds_A Back     alignment and structure
>2awp_A Iron super-oxide dismutase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.00A {Plasmodium knowlesi} PDB: 2bpi_A 2a03_A 2goj_A Back     alignment and structure
>3tqj_A Superoxide dismutase [FE]; oxidoreductase; 2.00A {Coxiella burnetii} Back     alignment and structure
>1xre_A SODA-2, superoxide dismutase; spine, oxidoreductase; 1.80A {Bacillus anthracis} Back     alignment and structure
>3js4_A Superoxide dismutase; niaid, ssgcid, seattle structural genomics center for infect disease, GRAM-negative bacteria; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>2nyb_A Superoxide dismutase [FE]; iron superoxide dismutase Q69E, fesod, oxidoreductase; 1.10A {Escherichia coli} SCOP: a.2.11.1 d.44.1.1 PDB: 2bkb_A 1isa_A 1isb_A 1isc_A 1za5_A 2w7w_A Back     alignment and structure
>3lio_A Iron superoxide dismutase; cold adaptation, flexibility, thermal stability, psychrophilic protein, metal-binding, oxidoreduc; HET: TRE; 1.50A {Pseudoalteromonas haloplanktis} PDB: 3lj9_A* 3ljf_A* 3sdp_A Back     alignment and structure
>1my6_A Iron (III) superoxide dismutase; iron speroxide dismutase, thermophIle, reactive oxygen species, cyanobacteria, SOD, fesod; 1.60A {Thermosynechococcus elongatus} SCOP: a.2.11.1 d.44.1.1 Back     alignment and structure
>2rcv_A Superoxide dismutase [MN]; bacillus subtilis,superoxide dismutase, manganese, metal- binding, oxidoreductase, phosphorylation; 1.60A {Bacillus subtilis} PDB: 1xuq_A 1jr9_A Back     alignment and structure
>3cei_A Superoxide dismutase; oxidoreductase; 2.40A {Helicobacter pylori} Back     alignment and structure
>1dt0_A Superoxide dismutase; pseudomonas ovalis, oxidoreductase; 2.10A {Pseudomonas putida} SCOP: a.2.11.1 d.44.1.1 Back     alignment and structure
>1uer_A SOD, superoxide dismutase; metal-specific, cambialistic, oxidoreductase; 1.60A {Porphyromonas gingivalis} SCOP: a.2.11.1 d.44.1.1 PDB: 1qnn_A 1ues_A Back     alignment and structure
>4f2n_A Superoxide dismutase; ssgcid, NIH, niaid, SBRI, emerald biostructures, structural national institute of allergy and infectious diseases; 1.85A {Leishmania major} Back     alignment and structure
>1gv3_A Manganese superoxide dismutase; anabaena PCC 7120,; 2.0A {Anabaena SP} SCOP: a.2.11.1 d.44.1.1 Back     alignment and structure
>1kkc_A Mnsod, manganese superoxide dismutase; homotetramer, oxidoreductase; 2.00A {Aspergillus fumigatus} SCOP: a.2.11.1 d.44.1.1 Back     alignment and structure
>3kky_A Mnsod, superoxide dismutase [MN]; manganese, ME binding, oxidoreductase, metal binding protein; 1.80A {Deinococcus radiodurans} PDB: 2cdy_A 2ce4_A 1y67_A 2aw9_A Back     alignment and structure
>3tjt_A Superoxide dismutase; metal ION binding, rossmann fold, oxidoreductase; 1.80A {Clostridium difficile} Back     alignment and structure
>2cw2_A Superoxide dismutase 1; SOD, oxidoreductase; 1.86A {Perkinsus marinus} Back     alignment and structure
>2gpc_A Iron superoxide dismutase; alpha+beta structure, oxidoreductase; 1.90A {Trypanosoma cruzi} PDB: 3esf_A Back     alignment and structure
>3h1s_A Superoxide dismutase; SOBD, csgid, oxidoreductase, structura genomics; 1.90A {Francisella tularensis subsp} Back     alignment and structure
>1coj_A Protein (superoxide dismutase); oxidoreductase; 1.90A {Aquifex pyrophilus} SCOP: a.2.11.1 d.44.1.1 Back     alignment and structure
>1ix9_A Mnsod, superoxide dismutase; manganese superoxide dismutase, Y174F mutant, hydrogen bond, reactivity, ultra-high resolution, oxidoreductase; 0.90A {Escherichia coli} SCOP: a.2.11.1 d.44.1.1 PDB: 1i0h_A 1ixb_A 1zlz_A 1d5n_A 1mmm_A 1vew_A 3k9s_A 3ot7_A 1en5_A 1en4_A 1i08_A 1en6_A Back     alignment and structure
>2cw3_A Pmsod2, iron superoxide dismutase; oxidoreductase; 2.50A {Perkinsus marinus} Back     alignment and structure
>4h3e_A Fesod, superoxide dismutase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.25A {Trypanosoma cruzi} Back     alignment and structure
>1unf_X Iron superoxide dismutase; oxidoreductase, eukaryotic, metalloprotein; 1.97A {Vigna unguiculata} SCOP: a.2.11.1 d.44.1.1 Back     alignment and structure
>2jb0_B Colicin E7; hydrolase/inhibitor, hydrolase/inhibitor complex, zinc, toxin, plasmid, nuclease, hydrolase, antibiotic, H-N-H motif, bacteriocin; 1.91A {Escherichia coli} SCOP: d.4.1.1 PDB: 3fbd_A 2jaz_B 2jbg_B 3gkl_A 3gjn_B 1pt3_A 2ivh_A 1ujz_B 2erh_B Back     alignment and structure
>1fr2_B Colicin E9; protein-protein complex, zinc containing enzyme, HNH-motif, immune system; 1.60A {Escherichia coli} SCOP: d.4.1.1 PDB: 1bxi_B 1emv_B 1fsj_B 2gyk_B 2gze_B 2gzf_B 2gzg_B 2gzi_B 2gzj_B 2k5x_B 2vlo_B 2wpt_B 2vlp_B 2vln_B 2vlq_B 1v13_A 1v14_A 1v15_A 3u43_B 1znv_B ... Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 139
d1ma1a2113 d.44.1.1 (A:92-204) Fe superoxide dismutase (FeSOD 6e-36
d1wb8a2116 d.44.1.1 (A:93-208) Fe superoxide dismutase (FeSOD 7e-35
d2p4ka2115 d.44.1.1 (A:84-198) Mn superoxide dismutase (MnSOD 2e-34
d1coja2122 d.44.1.1 (A:91-212) Fe superoxide dismutase (FeSOD 3e-34
d1mnga2111 d.44.1.1 (A:93-203) Mn superoxide dismutase (MnSOD 1e-32
d1p7ga2119 d.44.1.1 (A:104-222) Fe superoxide dismutase (FeSO 2e-32
d1bsma2115 d.44.1.1 (A:87-201) Cambialistic superoxide dismut 2e-32
d1unfx2134 d.44.1.1 (X:105-238) Fe superoxide dismutase (FeSO 5e-32
d1kkca2116 d.44.1.1 (A:98-213) Mn superoxide dismutase (MnSOD 1e-31
d1idsa2114 d.44.1.1 (A:86-199) Fe superoxide dismutase (FeSOD 1e-31
d1my6a2110 d.44.1.1 (A:89-198) Fe superoxide dismutase (FeSOD 4e-31
d1gv3a2111 d.44.1.1 (A:127-237) Mn superoxide dismutase (MnSO 2e-30
d1jr9a2111 d.44.1.1 (A:92-202) Mn superoxide dismutase (MnSOD 3e-30
d1uera2107 d.44.1.1 (A:85-191) Cambialistic superoxide dismut 3e-30
d1dt0a2114 d.44.1.1 (A:84-197) Fe superoxide dismutase (FeSOD 6e-30
d2nyba2110 d.44.1.1 (A:83-192) Fe superoxide dismutase (FeSOD 2e-29
d1y67a2116 d.44.1.1 (A:98-213) Mn superoxide dismutase (MnSOD 3e-29
d1ix9a2115 d.44.1.1 (A:91-205) Mn superoxide dismutase (MnSOD 9e-29
d1idsa184 a.2.11.1 (A:2-85) Fe superoxide dismutase (FeSOD) 8e-04
d1gv3a1102 a.2.11.1 (A:25-126) Mn superoxide dismutase (MnSOD 9e-04
d1p7ga192 a.2.11.1 (A:12-103) Fe superoxide dismutase (FeSOD 0.001
d1jr9a190 a.2.11.1 (A:2-91) Mn superoxide dismutase (MnSOD) 0.001
d1mnga192 a.2.11.1 (A:1-92) Mn superoxide dismutase (MnSOD) 0.001
d1bsma186 a.2.11.1 (A:1-86) Cambialistic superoxide dismutas 0.001
d1kkca184 a.2.11.1 (A:14-97) Mn superoxide dismutase (MnSOD) 0.001
d1ma1a188 a.2.11.1 (A:4-91) Fe superoxide dismutase (FeSOD) 0.002
d1uera184 a.2.11.1 (A:1-84) Cambialistic superoxide dismutas 0.003
d2p4ka183 a.2.11.1 (A:1-83) Mn superoxide dismutase (MnSOD) 0.003
d2nyba182 a.2.11.1 (A:1-82) Fe superoxide dismutase (FeSOD) 0.003
d1my6a188 a.2.11.1 (A:1-88) Fe superoxide dismutase (FeSOD) 0.003
d1coja189 a.2.11.1 (A:2-90) Fe superoxide dismutase (FeSOD) 0.004
>d1ma1a2 d.44.1.1 (A:92-204) Fe superoxide dismutase (FeSOD) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 113 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Fe,Mn superoxide dismutase (SOD), C-terminal domain
superfamily: Fe,Mn superoxide dismutase (SOD), C-terminal domain
family: Fe,Mn superoxide dismutase (SOD), C-terminal domain
domain: Fe superoxide dismutase (FeSOD)
species: Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]

 Score =  117 bits (295), Expect = 6e-36
 Identities = 42/114 (36%), Positives = 59/114 (51%), Gaps = 3/114 (2%)

Query: 23  EGGGEPPHSSLGWAIDTHFGSLEALIQKMSAEGAALQGSGWVWLGLDTEFKRLVVETTAN 82
           E GGEP    L   I+  FGS E   ++ S    + +GSGW  L       RL +     
Sbjct: 1   ECGGEPS-GKLAEYIEKDFGSFERFRKEFSQAAISAEGSGWAVLTYCQRTDRLFIMQVEK 59

Query: 83  QDPLVTKAPTLVPLLGIDVWEHAYYLQYKNVKPDYLKNIWNVMNWKYASDVYQK 136
            +  V   P    LL +DVWEHAYY+ Y+NV+PDY++  WN++NWK     ++ 
Sbjct: 60  HNVNVI--PHFRILLVLDVWEHAYYIDYRNVRPDYVEAFWNIVNWKEVEKRFED 111
>d1wb8a2 d.44.1.1 (A:93-208) Fe superoxide dismutase (FeSOD) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 116 Back     information, alignment and structure
>d2p4ka2 d.44.1.1 (A:84-198) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens) [TaxId: 9606]} Length = 115 Back     information, alignment and structure
>d1coja2 d.44.1.1 (A:91-212) Fe superoxide dismutase (FeSOD) {Aquifex pyrophilus [TaxId: 2714]} Length = 122 Back     information, alignment and structure
>d1mnga2 d.44.1.1 (A:93-203) Mn superoxide dismutase (MnSOD) {Thermus thermophilus [TaxId: 274]} Length = 111 Back     information, alignment and structure
>d1p7ga2 d.44.1.1 (A:104-222) Fe superoxide dismutase (FeSOD) {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 119 Back     information, alignment and structure
>d1bsma2 d.44.1.1 (A:87-201) Cambialistic superoxide dismutase {Propionibacterium shermanii [TaxId: 1752]} Length = 115 Back     information, alignment and structure
>d1unfx2 d.44.1.1 (X:105-238) Fe superoxide dismutase (FeSOD) {Cowpea (Vigna unguiculata) [TaxId: 3917]} Length = 134 Back     information, alignment and structure
>d1kkca2 d.44.1.1 (A:98-213) Mn superoxide dismutase (MnSOD) {Aspergillus fumigatus [TaxId: 5085]} Length = 116 Back     information, alignment and structure
>d1idsa2 d.44.1.1 (A:86-199) Fe superoxide dismutase (FeSOD) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 114 Back     information, alignment and structure
>d1my6a2 d.44.1.1 (A:89-198) Fe superoxide dismutase (FeSOD) {Thermosynechococcus elongatus [TaxId: 146786]} Length = 110 Back     information, alignment and structure
>d1gv3a2 d.44.1.1 (A:127-237) Mn superoxide dismutase (MnSOD) {Anabaena sp. [TaxId: 1167]} Length = 111 Back     information, alignment and structure
>d1jr9a2 d.44.1.1 (A:92-202) Mn superoxide dismutase (MnSOD) {Bacillus halodenitrificans [TaxId: 1482]} Length = 111 Back     information, alignment and structure
>d1uera2 d.44.1.1 (A:85-191) Cambialistic superoxide dismutase {Porphyromonas gingivalis [TaxId: 837]} Length = 107 Back     information, alignment and structure
>d1dt0a2 d.44.1.1 (A:84-197) Fe superoxide dismutase (FeSOD) {Pseudomonas ovalis [TaxId: 303]} Length = 114 Back     information, alignment and structure
>d2nyba2 d.44.1.1 (A:83-192) Fe superoxide dismutase (FeSOD) {Escherichia coli [TaxId: 562]} Length = 110 Back     information, alignment and structure
>d1y67a2 d.44.1.1 (A:98-213) Mn superoxide dismutase (MnSOD) {Deinococcus radiodurans [TaxId: 1299]} Length = 116 Back     information, alignment and structure
>d1ix9a2 d.44.1.1 (A:91-205) Mn superoxide dismutase (MnSOD) {Escherichia coli [TaxId: 562]} Length = 115 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query139
d1wb8a2116 Fe superoxide dismutase (FeSOD) {Archaeon Sulfolob 100.0
d1ma1a2113 Fe superoxide dismutase (FeSOD) {Archaeon Methanob 100.0
d1mnga2111 Mn superoxide dismutase (MnSOD) {Thermus thermophi 100.0
d1gv3a2111 Mn superoxide dismutase (MnSOD) {Anabaena sp. [Tax 100.0
d2p4ka2115 Mn superoxide dismutase (MnSOD) {Human (Homo sapie 100.0
d1idsa2114 Fe superoxide dismutase (FeSOD) {Mycobacterium tub 100.0
d1p7ga2119 Fe superoxide dismutase (FeSOD) {Archaeon Pyrobacu 100.0
d1bsma2115 Cambialistic superoxide dismutase {Propionibacteri 100.0
d1kkca2116 Mn superoxide dismutase (MnSOD) {Aspergillus fumig 100.0
d2nyba2110 Fe superoxide dismutase (FeSOD) {Escherichia coli 100.0
d1dt0a2114 Fe superoxide dismutase (FeSOD) {Pseudomonas ovali 100.0
d1my6a2110 Fe superoxide dismutase (FeSOD) {Thermosynechococc 100.0
d1uera2107 Cambialistic superoxide dismutase {Porphyromonas g 100.0
d1jr9a2111 Mn superoxide dismutase (MnSOD) {Bacillus halodeni 100.0
d1coja2122 Fe superoxide dismutase (FeSOD) {Aquifex pyrophilu 100.0
d1unfx2134 Fe superoxide dismutase (FeSOD) {Cowpea (Vigna ung 100.0
d1ix9a2115 Mn superoxide dismutase (MnSOD) {Escherichia coli 100.0
d1y67a2116 Mn superoxide dismutase (MnSOD) {Deinococcus radio 100.0
>d1wb8a2 d.44.1.1 (A:93-208) Fe superoxide dismutase (FeSOD) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Fe,Mn superoxide dismutase (SOD), C-terminal domain
superfamily: Fe,Mn superoxide dismutase (SOD), C-terminal domain
family: Fe,Mn superoxide dismutase (SOD), C-terminal domain
domain: Fe superoxide dismutase (FeSOD)
species: Archaeon Sulfolobus solfataricus [TaxId: 2287]

Probab=100.00  E-value=5.1e-54  Score=306.35  Aligned_cols=112  Identities=37%  Similarity=0.595  Sum_probs=105.6

Q ss_pred             CCCCCchhHHHHHHhhcCCHHHHHHHHHHHhhcCccCceEEEEEeCCCCeeEEEEecCCCccccCCCCCceEEEeccCch
Q 032513           25 GGEPPHSSLGWAIDTHFGSLEALIQKMSAEGAALQGSGWVWLGLDTEFKRLVVETTANQDPLVTKAPTLVPLLGIDVWEH  104 (139)
Q Consensus        25 ~~~~p~~~L~~~I~~~FGS~d~fk~~f~~~a~~~~GsGW~wLv~d~~~~~L~i~~t~n~~p~~~~g~~~~PlL~iDvwEH  104 (139)
                      |++.|++.|+++|+++|||+|+||++|+++|.++|||||+|||+|+++++|.|++|+||+.+...+  ..||||||||||
T Consensus         5 Gg~~P~g~l~~~I~~~FGS~d~fk~~f~~~a~~~~GsGW~wLv~~~~~~~l~i~~~~n~~~~~~~~--~~piL~lDvWEH   82 (116)
T d1wb8a2           5 GGGKPGGALADLINKQYGSFDRFKQVFTETANSLPGTGWAVLYYDTESGNLQIMTFENHFQNHIAE--IPIILILDEFEH   82 (116)
T ss_dssp             BSSCCCHHHHHHHHHHHSSHHHHHHHHHHHHHTCCSSEEEEEEECTTTCCEEEEEEETTTBSCCSS--CCEEEEEECSGG
T ss_pred             CCCCCCHHHHHHHHHHhCCHHHHHHHHHHHHhcCcccceEEEEEeCcCCcccccccccCCCCccCC--Cceeeeecchhh
Confidence            445799999999999999999999999999999999999999999988999999999997665556  799999999999


Q ss_pred             hhHhhhcCChHHHHHHHhhcCCHHHHHHHHHhhC
Q 032513          105 AYYLQYKNVKPDYLKNIWNVMNWKYASDVYQKEC  138 (139)
Q Consensus       105 AYy~dY~n~r~~Yi~~~w~~inW~~v~~r~~~~~  138 (139)
                      |||+||+|+|++||++||++|||++||+||++|+
T Consensus        83 AYyldY~n~r~~Yi~~~~~~iNW~~ve~rl~~~~  116 (116)
T d1wb8a2          83 AYYLQYKNKRADYVNAWWNVVNWDAAEKKLQKYL  116 (116)
T ss_dssp             GTHHHHTTCHHHHHHHHGGGBCHHHHHHHHHHTC
T ss_pred             hhHHHHhccHHHHHHHHHHHcCHHHHHHHHHHhC
Confidence            9999999999999999999999999999999985
>d1ma1a2 d.44.1.1 (A:92-204) Fe superoxide dismutase (FeSOD) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1mnga2 d.44.1.1 (A:93-203) Mn superoxide dismutase (MnSOD) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1gv3a2 d.44.1.1 (A:127-237) Mn superoxide dismutase (MnSOD) {Anabaena sp. [TaxId: 1167]} Back     information, alignment and structure
>d2p4ka2 d.44.1.1 (A:84-198) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1idsa2 d.44.1.1 (A:86-199) Fe superoxide dismutase (FeSOD) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1p7ga2 d.44.1.1 (A:104-222) Fe superoxide dismutase (FeSOD) {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1bsma2 d.44.1.1 (A:87-201) Cambialistic superoxide dismutase {Propionibacterium shermanii [TaxId: 1752]} Back     information, alignment and structure
>d1kkca2 d.44.1.1 (A:98-213) Mn superoxide dismutase (MnSOD) {Aspergillus fumigatus [TaxId: 5085]} Back     information, alignment and structure
>d2nyba2 d.44.1.1 (A:83-192) Fe superoxide dismutase (FeSOD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dt0a2 d.44.1.1 (A:84-197) Fe superoxide dismutase (FeSOD) {Pseudomonas ovalis [TaxId: 303]} Back     information, alignment and structure
>d1my6a2 d.44.1.1 (A:89-198) Fe superoxide dismutase (FeSOD) {Thermosynechococcus elongatus [TaxId: 146786]} Back     information, alignment and structure
>d1uera2 d.44.1.1 (A:85-191) Cambialistic superoxide dismutase {Porphyromonas gingivalis [TaxId: 837]} Back     information, alignment and structure
>d1jr9a2 d.44.1.1 (A:92-202) Mn superoxide dismutase (MnSOD) {Bacillus halodenitrificans [TaxId: 1482]} Back     information, alignment and structure
>d1coja2 d.44.1.1 (A:91-212) Fe superoxide dismutase (FeSOD) {Aquifex pyrophilus [TaxId: 2714]} Back     information, alignment and structure
>d1unfx2 d.44.1.1 (X:105-238) Fe superoxide dismutase (FeSOD) {Cowpea (Vigna unguiculata) [TaxId: 3917]} Back     information, alignment and structure
>d1ix9a2 d.44.1.1 (A:91-205) Mn superoxide dismutase (MnSOD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y67a2 d.44.1.1 (A:98-213) Mn superoxide dismutase (MnSOD) {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure