Citrus Sinensis ID: 032523
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 139 | ||||||
| 357512103 | 139 | Histone H2A [Medicago truncatula] gi|357 | 1.0 | 1.0 | 0.906 | 1e-66 | |
| 225451096 | 139 | PREDICTED: histone H2AX [Vitis vinifera] | 1.0 | 1.0 | 0.906 | 1e-66 | |
| 449435726 | 140 | PREDICTED: probable histone H2AXb-like [ | 0.992 | 0.985 | 0.913 | 1e-66 | |
| 449462308 | 139 | PREDICTED: histone H2AX-like [Cucumis sa | 1.0 | 1.0 | 0.906 | 4e-66 | |
| 224131422 | 142 | histone 2 [Populus trichocarpa] gi|22283 | 0.964 | 0.943 | 0.925 | 6e-66 | |
| 351724209 | 140 | uncharacterized protein LOC100305465 [Gl | 0.992 | 0.985 | 0.898 | 1e-65 | |
| 224123274 | 142 | histone 2 [Populus trichocarpa] gi|22285 | 0.964 | 0.943 | 0.917 | 3e-65 | |
| 255559382 | 139 | histone h2a, putative [Ricinus communis] | 0.992 | 0.992 | 0.921 | 3e-65 | |
| 15214035 | 139 | RecName: Full=Histone H2AX gi|3204129|em | 1.0 | 1.0 | 0.884 | 3e-65 | |
| 297849188 | 142 | hypothetical protein ARALYDRAFT_888122 [ | 0.978 | 0.957 | 0.904 | 1e-64 |
| >gi|357512103|ref|XP_003626340.1| Histone H2A [Medicago truncatula] gi|357512107|ref|XP_003626342.1| Histone H2A [Medicago truncatula] gi|124360158|gb|ABN08174.1| Histone H2A; Histone-fold [Medicago truncatula] gi|124360160|gb|ABN08176.1| Histone H2A; Histone-fold [Medicago truncatula] gi|355501355|gb|AES82558.1| Histone H2A [Medicago truncatula] gi|355501357|gb|AES82560.1| Histone H2A [Medicago truncatula] gi|388498640|gb|AFK37386.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
Score = 257 bits (657), Expect = 1e-66, Method: Compositional matrix adjust.
Identities = 126/139 (90%), Positives = 134/139 (96%)
Query: 1 MSSAGSTKGGRGKPKSTKSISRSHKAGLQFPVGRIARFLKAGKYADRVGAGAPVYLSAVL 60
MSS G+TKGGRGKPK+ KS+SRS KAGLQFPVGRIARFLKAGKYA+RVGAGAPVYLSAVL
Sbjct: 1 MSSTGTTKGGRGKPKAAKSVSRSSKAGLQFPVGRIARFLKAGKYAERVGAGAPVYLSAVL 60
Query: 61 EYLAAEVLELAGNAARDNKKNRIVPRHIQLAVRNDEELSKLLGTVTIANGGVLPNIHQNL 120
EYLAAEVLELAGNAARDNKKNRIVPRHIQLAVRNDEELSKLLGTVTIANGGVLPNIHQ L
Sbjct: 61 EYLAAEVLELAGNAARDNKKNRIVPRHIQLAVRNDEELSKLLGTVTIANGGVLPNIHQTL 120
Query: 121 LPRKMGKGREDIGSASQEF 139
LP+K+GKG+ +IGSASQEF
Sbjct: 121 LPKKVGKGKGEIGSASQEF 139
|
Source: Medicago truncatula Species: Medicago truncatula Genus: Medicago Family: Fabaceae Order: Fabales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225451096|ref|XP_002265878.1| PREDICTED: histone H2AX [Vitis vinifera] gi|147815277|emb|CAN70026.1| hypothetical protein VITISV_030174 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449435726|ref|XP_004135645.1| PREDICTED: probable histone H2AXb-like [Cucumis sativus] gi|449485770|ref|XP_004157270.1| PREDICTED: probable histone H2AXb-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449462308|ref|XP_004148883.1| PREDICTED: histone H2AX-like [Cucumis sativus] gi|449528788|ref|XP_004171385.1| PREDICTED: histone H2AX-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|224131422|ref|XP_002328535.1| histone 2 [Populus trichocarpa] gi|222838250|gb|EEE76615.1| histone 2 [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|351724209|ref|NP_001235770.1| uncharacterized protein LOC100305465 [Glycine max] gi|255625587|gb|ACU13138.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|224123274|ref|XP_002319038.1| histone 2 [Populus trichocarpa] gi|222857414|gb|EEE94961.1| histone 2 [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255559382|ref|XP_002520711.1| histone h2a, putative [Ricinus communis] gi|223540096|gb|EEF41673.1| histone h2a, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|15214035|sp|O65759.1|H2AX_CICAR RecName: Full=Histone H2AX gi|3204129|emb|CAA07234.1| histone H2A [Cicer arietinum] | Back alignment and taxonomy information |
|---|
| >gi|297849188|ref|XP_002892475.1| hypothetical protein ARALYDRAFT_888122 [Arabidopsis lyrata subsp. lyrata] gi|297338317|gb|EFH68734.1| hypothetical protein ARALYDRAFT_888122 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 139 | ||||||
| TAIR|locus:2199486 | 142 | GAMMA-H2AX "gamma histone vari | 0.992 | 0.971 | 0.753 | 2.2e-50 | |
| TAIR|locus:2036054 | 142 | H2AXA [Arabidopsis thaliana (t | 0.992 | 0.971 | 0.746 | 4.6e-50 | |
| TAIR|locus:2172119 | 130 | RAT5 "RESISTANT TO AGROBACTERI | 0.920 | 0.984 | 0.669 | 2.1e-38 | |
| TAIR|locus:2131704 | 131 | HTA2 "histone H2A 2" [Arabidop | 0.863 | 0.916 | 0.685 | 1.9e-37 | |
| TAIR|locus:2026032 | 132 | HTA10 "histone H2A 10" [Arabid | 0.906 | 0.954 | 0.651 | 1e-36 | |
| TAIR|locus:2083430 | 132 | HTA13 "histone H2A 13" [Arabid | 0.906 | 0.954 | 0.666 | 1e-36 | |
| CGD|CAL0000204 | 132 | HTA1 [Candida albicans (taxid: | 0.913 | 0.962 | 0.598 | 3.1e-35 | |
| UNIPROTKB|Q59SU5 | 132 | HTA1 "Histone H2A.1" [Candida | 0.913 | 0.962 | 0.598 | 3.1e-35 | |
| CGD|CAL0001183 | 131 | HTA2 [Candida albicans (taxid: | 0.906 | 0.961 | 0.590 | 2.2e-34 | |
| ASPGD|ASPL0000038151 | 132 | H2A.X [Emericella nidulans (ta | 0.892 | 0.939 | 0.592 | 7.4e-34 |
| TAIR|locus:2199486 GAMMA-H2AX "gamma histone variant H2AX" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 524 (189.5 bits), Expect = 2.2e-50, P = 2.2e-50
Identities = 104/138 (75%), Positives = 113/138 (81%)
Query: 2 SSAGSTKGGRGKPKSTKSISRSHKAGLQFPVGRIARFLKAGKYADRVGAGAPXXXXXXXX 61
+ +G+TKGGRGKPK+TKS+SRS KAGLQFPVGRIARFLKAGKYA+RVGAGAP
Sbjct: 5 AGSGTTKGGRGKPKATKSVSRSSKAGLQFPVGRIARFLKAGKYAERVGAGAPVYLSAVLE 64
Query: 62 XXXXXXXXXXGNAARDNKKNRIVPRHIQLAVRNDEELSKLLGTVTIANGGVLPNIHQNLL 121
GNAARDNKK RIVPRHIQLAVRNDEELSKLLG+VTIANGGVLPNIHQ LL
Sbjct: 65 YLAAEVLELAGNAARDNKKTRIVPRHIQLAVRNDEELSKLLGSVTIANGGVLPNIHQTLL 124
Query: 122 PRKMGKGREDIGSASQEF 139
P K+GK + DIGSASQEF
Sbjct: 125 PSKVGKNKGDIGSASQEF 142
|
|
| TAIR|locus:2036054 H2AXA [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2172119 RAT5 "RESISTANT TO AGROBACTERIUM TRANSFORMATION 5" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2131704 HTA2 "histone H2A 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2026032 HTA10 "histone H2A 10" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2083430 HTA13 "histone H2A 13" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| CGD|CAL0000204 HTA1 [Candida albicans (taxid:5476)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q59SU5 HTA1 "Histone H2A.1" [Candida albicans SC5314 (taxid:237561)] | Back alignment and assigned GO terms |
|---|
| CGD|CAL0001183 HTA2 [Candida albicans (taxid:5476)] | Back alignment and assigned GO terms |
|---|
| ASPGD|ASPL0000038151 H2A.X [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00006109001 | RecName- Full=Histone H2A; (139 aa) | ||||||||||
(Vitis vinifera) | |||||||||||
| GSVIVG00024423001 | • | • | 0.483 | ||||||||
| GSVIVG00036813001 | • | 0.483 | |||||||||
| GSVIVG00034895001 | • | 0.483 | |||||||||
| GSVIVG00027005001 | • | 0.483 | |||||||||
| GSVIVG00024652001 | • | 0.483 | |||||||||
| GSVIVG00013065001 | • | 0.483 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 139 | |||
| PLN00156 | 139 | PLN00156, PLN00156, histone H2AX; Provisional | 1e-81 | |
| PLN00157 | 132 | PLN00157, PLN00157, histone H2A; Provisional | 4e-69 | |
| PTZ00017 | 134 | PTZ00017, PTZ00017, histone H2A; Provisional | 7e-69 | |
| cd00074 | 115 | cd00074, H2A, Histone 2A; H2A is a subunit of the | 1e-62 | |
| smart00414 | 106 | smart00414, H2A, Histone 2A | 4e-61 | |
| PLN00153 | 129 | PLN00153, PLN00153, histone H2A; Provisional | 1e-55 | |
| COG5262 | 132 | COG5262, HTA1, Histone H2A [Chromatin structure an | 1e-51 | |
| PLN00154 | 136 | PLN00154, PLN00154, histone H2A; Provisional | 3e-38 | |
| PTZ00252 | 134 | PTZ00252, PTZ00252, histone H2A; Provisional | 4e-28 | |
| pfam00125 | 75 | pfam00125, Histone, Core histone H2A/H2B/H3/H4 | 9e-25 | |
| PLN00155 | 58 | PLN00155, PLN00155, histone H2A; Provisional | 5e-19 | |
| COG5247 | 113 | COG5247, BUR6, Class 2 transcription repressor NC2 | 5e-07 | |
| COG2036 | 91 | COG2036, HHT1, Histones H3 and H4 [Chromatin struc | 0.003 | |
| pfam00808 | 65 | pfam00808, CBFD_NFYB_HMF, Histone-like transcripti | 0.004 |
| >gnl|CDD|215080 PLN00156, PLN00156, histone H2AX; Provisional | Back alignment and domain information |
|---|
Score = 236 bits (602), Expect = 1e-81
Identities = 123/138 (89%), Positives = 133/138 (96%)
Query: 2 SSAGSTKGGRGKPKSTKSISRSHKAGLQFPVGRIARFLKAGKYADRVGAGAPVYLSAVLE 61
+ +G+TKGGRGKPK+TKS+SRS KAGLQFPVGRIARFLKAGKYA+RVGAGAPVYLSAVLE
Sbjct: 2 AGSGTTKGGRGKPKATKSVSRSSKAGLQFPVGRIARFLKAGKYAERVGAGAPVYLSAVLE 61
Query: 62 YLAAEVLELAGNAARDNKKNRIVPRHIQLAVRNDEELSKLLGTVTIANGGVLPNIHQNLL 121
YLAAEVLELAGNAARDNKKNRIVPRHIQLAVRNDEELSKLLG+VTIA GGVLPNIHQ LL
Sbjct: 62 YLAAEVLELAGNAARDNKKNRIVPRHIQLAVRNDEELSKLLGSVTIAAGGVLPNIHQTLL 121
Query: 122 PRKMGKGREDIGSASQEF 139
P+K+GKG+ DIGSASQEF
Sbjct: 122 PKKVGKGKGDIGSASQEF 139
|
Length = 139 |
| >gnl|CDD|177758 PLN00157, PLN00157, histone H2A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185399 PTZ00017, PTZ00017, histone H2A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238029 cd00074, H2A, Histone 2A; H2A is a subunit of the nucleosome | Back alignment and domain information |
|---|
| >gnl|CDD|197711 smart00414, H2A, Histone 2A | Back alignment and domain information |
|---|
| >gnl|CDD|165721 PLN00153, PLN00153, histone H2A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227587 COG5262, HTA1, Histone H2A [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >gnl|CDD|177756 PLN00154, PLN00154, histone H2A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240330 PTZ00252, PTZ00252, histone H2A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|201020 pfam00125, Histone, Core histone H2A/H2B/H3/H4 | Back alignment and domain information |
|---|
| >gnl|CDD|165723 PLN00155, PLN00155, histone H2A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227572 COG5247, BUR6, Class 2 transcription repressor NC2, alpha subunit (DRAP1 homolog) [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|224947 COG2036, HHT1, Histones H3 and H4 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >gnl|CDD|201453 pfam00808, CBFD_NFYB_HMF, Histone-like transcription factor (CBF/NF-Y) and archaeal histone | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 139 | |||
| PLN00156 | 139 | histone H2AX; Provisional | 100.0 | |
| PLN00153 | 129 | histone H2A; Provisional | 100.0 | |
| PTZ00017 | 134 | histone H2A; Provisional | 100.0 | |
| PTZ00252 | 134 | histone H2A; Provisional | 100.0 | |
| PLN00157 | 132 | histone H2A; Provisional | 100.0 | |
| KOG1756 | 131 | consensus Histone 2A [Chromatin structure and dyna | 100.0 | |
| PLN00154 | 136 | histone H2A; Provisional | 100.0 | |
| cd00074 | 115 | H2A Histone 2A; H2A is a subunit of the nucleosome | 100.0 | |
| smart00414 | 106 | H2A Histone 2A. | 100.0 | |
| COG5262 | 132 | HTA1 Histone H2A [Chromatin structure and dynamics | 100.0 | |
| KOG1757 | 131 | consensus Histone 2A [Chromatin structure and dyna | 100.0 | |
| PLN00155 | 58 | histone H2A; Provisional | 99.86 | |
| COG5247 | 113 | BUR6 Class 2 transcription repressor NC2, alpha su | 99.62 | |
| PF00125 | 75 | Histone: Core histone H2A/H2B/H3/H4 histone h2a si | 99.55 | |
| PLN00035 | 103 | histone H4; Provisional | 99.4 | |
| KOG1659 | 224 | consensus Class 2 transcription repressor NC2, alp | 99.37 | |
| PTZ00015 | 102 | histone H4; Provisional | 99.26 | |
| PF00808 | 65 | CBFD_NFYB_HMF: Histone-like transcription factor ( | 99.2 | |
| smart00803 | 65 | TAF TATA box binding protein associated factor. TA | 98.98 | |
| COG2036 | 91 | HHT1 Histones H3 and H4 [Chromatin structure and d | 98.98 | |
| cd00076 | 85 | H4 Histone H4, one of the four histones, along wit | 98.85 | |
| COG5208 | 286 | HAP5 CCAAT-binding factor, subunit C [Transcriptio | 98.74 | |
| smart00417 | 74 | H4 Histone H4. | 98.73 | |
| KOG1657 | 236 | consensus CCAAT-binding factor, subunit C (HAP5) [ | 98.57 | |
| cd07981 | 72 | TAF12 TATA Binding Protein (TBP) Associated Factor | 98.25 | |
| cd07979 | 117 | TAF9 TATA Binding Protein (TBP) Associated Factor | 98.07 | |
| KOG3467 | 103 | consensus Histone H4 [Chromatin structure and dyna | 97.98 | |
| PF02969 | 66 | TAF: TATA box binding protein associated factor (T | 97.77 | |
| cd08048 | 85 | TAF11 TATA Binding Protein (TBP) Associated Factor | 97.69 | |
| PLN00158 | 116 | histone H2B; Provisional | 97.64 | |
| smart00576 | 77 | BTP Bromodomain transcription factors and PHD doma | 97.63 | |
| cd08050 | 343 | TAF6 TATA Binding Protein (TBP) Associated Factor | 97.62 | |
| smart00428 | 105 | H3 Histone H3. | 97.44 | |
| PF04719 | 90 | TAFII28: hTAFII28-like protein conserved region; I | 97.1 | |
| KOG3219 | 195 | consensus Transcription initiation factor TFIID, s | 97.0 | |
| KOG0869 | 168 | consensus CCAAT-binding factor, subunit A (HAP3) [ | 96.81 | |
| smart00427 | 89 | H2B Histone H2B. | 96.73 | |
| PTZ00463 | 117 | histone H2B; Provisional | 96.43 | |
| PF15511 | 414 | CENP-T: Centromere kinetochore component CENP-T; P | 96.42 | |
| KOG0871 | 156 | consensus Class 2 transcription repressor NC2, bet | 96.22 | |
| PF09415 | 72 | CENP-X: CENP-S associating Centromere protein X; I | 96.16 | |
| PF03847 | 68 | TFIID_20kDa: Transcription initiation factor TFIID | 96.11 | |
| PF15630 | 76 | CENP-S: Kinetochore component CENP-S; PDB: 4DRA_C | 95.92 | |
| KOG1658 | 162 | consensus DNA polymerase epsilon, subunit C [Repli | 95.67 | |
| PF02291 | 129 | TFIID-31kDa: Transcription initiation factor IID, | 95.4 | |
| PLN00160 | 97 | histone H3; Provisional | 95.37 | |
| PTZ00018 | 136 | histone H3; Provisional | 95.31 | |
| PF07524 | 77 | Bromo_TP: Bromodomain associated; InterPro: IPR006 | 95.27 | |
| PLN00121 | 136 | histone H3; Provisional | 95.02 | |
| KOG0870 | 172 | consensus DNA polymerase epsilon, subunit D [Trans | 94.99 | |
| PLN00161 | 135 | histone H3; Provisional | 94.98 | |
| KOG1744 | 127 | consensus Histone H2B [Chromatin structure and dyn | 94.47 | |
| KOG1142 | 258 | consensus Transcription initiation factor TFIID, s | 94.21 | |
| PLN00163 | 59 | histone H4; Provisional | 93.21 | |
| PF02269 | 93 | TFIID-18kDa: Transcription initiation factor IID, | 93.04 | |
| cd07978 | 92 | TAF13 The TATA Binding Protein (TBP) Associated Fa | 93.02 | |
| KOG1745 | 137 | consensus Histones H3 and H4 [Chromatin structure | 91.48 | |
| COG5094 | 145 | TAF9 Transcription initiation factor TFIID, subuni | 90.98 | |
| KOG3334 | 148 | consensus Transcription initiation factor TFIID, s | 84.32 | |
| COG5150 | 148 | Class 2 transcription repressor NC2, beta subunit | 82.2 | |
| COG5251 | 199 | TAF40 Transcription initiation factor TFIID, subun | 81.78 |
| >PLN00156 histone H2AX; Provisional | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.2e-51 Score=307.44 Aligned_cols=138 Identities=89% Similarity=1.307 Sum_probs=127.4
Q ss_pred CCCCCCCCCCCCCCCCCCcCcccccCcccchHHHHHHHHhCCCccccCCchHHHHHHHHHHHHHHHHHHHHHHHhhcCCC
Q 032523 2 SSAGSTKGGRGKPKSTKSISRSHKAGLQFPVGRIARFLKAGKYADRVGAGAPVYLSAVLEYLAAEVLELAGNAARDNKKN 81 (139)
Q Consensus 2 ~~~~~~~~~~~~~~~~~~~s~ssragL~fPvsri~R~Lk~~~~~~RVs~~A~vyLaAvLEyL~~EILelAg~~A~~~~~k 81 (139)
+|.|.+++||||+++++..|+|+||+|+|||+||+|+|++.+|+.||+++|||||+||||||++||||+|+|.|++++++
T Consensus 2 ~~~~~~~~~~g~~~~~k~~srS~rAgL~FPVgRi~R~Lk~g~ya~RVga~ApVYLAAVLEYLtaEVLELAgNaa~d~kk~ 81 (139)
T PLN00156 2 AGSGTTKGGRGKPKATKSVSRSSKAGLQFPVGRIARFLKAGKYAERVGAGAPVYLSAVLEYLAAEVLELAGNAARDNKKN 81 (139)
T ss_pred CCCCCCCCCCCcccccCCcCcccccCcccchHHHHHHHhcCChhhccCCccHHHHHHHHHHHHHHHHHHHHHHHHHcCCC
Confidence 35677899999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred ccchhhHHHhhhCcHHHHhhhcCceecCCccCCcccccccccccCCCCccCCccCCCC
Q 032523 82 RIVPRHIQLAVRNDEELSKLLGTVTIANGGVLPNIHQNLLPRKMGKGREDIGSASQEF 139 (139)
Q Consensus 82 rItP~hI~~AI~nD~EL~~L~~~~~Ia~ggv~P~i~~~l~~~k~~~~~~~~~~~~~~~ 139 (139)
+|+|+||++||+||+||+.||+++||++|||+|+||++|+++|.++++.+...++|++
T Consensus 82 RItPrHi~lAIrnDeEL~~Ll~~vTIa~GGV~P~i~~~l~~kk~~~~~~~~~~~~~~~ 139 (139)
T PLN00156 82 RIVPRHIQLAVRNDEELSKLLGSVTIAAGGVLPNIHQTLLPKKVGKGKGDIGSASQEF 139 (139)
T ss_pred cCcHHHHHhhccCcHHHHHHHCCCccCCCccCCCccHhhccccccccccccccccCCC
Confidence 9999999999999999999999999999999999999999999865533333446653
|
|
| >PLN00153 histone H2A; Provisional | Back alignment and domain information |
|---|
| >PTZ00017 histone H2A; Provisional | Back alignment and domain information |
|---|
| >PTZ00252 histone H2A; Provisional | Back alignment and domain information |
|---|
| >PLN00157 histone H2A; Provisional | Back alignment and domain information |
|---|
| >KOG1756 consensus Histone 2A [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PLN00154 histone H2A; Provisional | Back alignment and domain information |
|---|
| >cd00074 H2A Histone 2A; H2A is a subunit of the nucleosome | Back alignment and domain information |
|---|
| >smart00414 H2A Histone 2A | Back alignment and domain information |
|---|
| >COG5262 HTA1 Histone H2A [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG1757 consensus Histone 2A [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PLN00155 histone H2A; Provisional | Back alignment and domain information |
|---|
| >COG5247 BUR6 Class 2 transcription repressor NC2, alpha subunit (DRAP1 homolog) [Transcription] | Back alignment and domain information |
|---|
| >PF00125 Histone: Core histone H2A/H2B/H3/H4 histone h2a signature histone h2b signature histone h3 signature histone h4 signature; InterPro: IPR007125 The core histones together with some other DNA binding proteins appear to form a superfamily defined by a common fold and distant sequence similarities [, ] | Back alignment and domain information |
|---|
| >PLN00035 histone H4; Provisional | Back alignment and domain information |
|---|
| >KOG1659 consensus Class 2 transcription repressor NC2, alpha subunit (DRAP1) [Transcription] | Back alignment and domain information |
|---|
| >PTZ00015 histone H4; Provisional | Back alignment and domain information |
|---|
| >PF00808 CBFD_NFYB_HMF: Histone-like transcription factor (CBF/NF-Y) and archaeal histone; InterPro: IPR003958 The CCAAT-binding factor (CBF) is a mammalian transcription factor that binds to a CCAAT motif in the promoters of a wide variety of genes, including type I collagen and albumin | Back alignment and domain information |
|---|
| >smart00803 TAF TATA box binding protein associated factor | Back alignment and domain information |
|---|
| >COG2036 HHT1 Histones H3 and H4 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >cd00076 H4 Histone H4, one of the four histones, along with H2A, H2B and H3, which forms the eukaryotic nucleosome core; along with H3, it plays a central role in nucleosome formation; histones bind to DNA and wrap the genetic material into "beads on a string" in which DNA (the string) is wrapped around small blobs of histones (the beads) at regular intervals; play a role in the inheritance of specialized chromosome structures and the control of gene activity; defects in the establishment of proper chromosome structure by histones may activate or silence genes aberrantly and thus lead to disease; the sequence of histone H4 has remained almost invariant in more than 2 billion years of evolution | Back alignment and domain information |
|---|
| >COG5208 HAP5 CCAAT-binding factor, subunit C [Transcription] | Back alignment and domain information |
|---|
| >smart00417 H4 Histone H4 | Back alignment and domain information |
|---|
| >KOG1657 consensus CCAAT-binding factor, subunit C (HAP5) [Transcription] | Back alignment and domain information |
|---|
| >cd07981 TAF12 TATA Binding Protein (TBP) Associated Factor 12 (TAF12) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex | Back alignment and domain information |
|---|
| >cd07979 TAF9 TATA Binding Protein (TBP) Associated Factor 9 (TAF9) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex | Back alignment and domain information |
|---|
| >KOG3467 consensus Histone H4 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PF02969 TAF: TATA box binding protein associated factor (TAF); InterPro: IPR004823 The TATA box binding protein associated factor (TAF) is part of the transcription initiation factor TFIID multimeric protein complex | Back alignment and domain information |
|---|
| >cd08048 TAF11 TATA Binding Protein (TBP) Associated Factor 11 (TAF11) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex | Back alignment and domain information |
|---|
| >PLN00158 histone H2B; Provisional | Back alignment and domain information |
|---|
| >smart00576 BTP Bromodomain transcription factors and PHD domain containing proteins | Back alignment and domain information |
|---|
| >cd08050 TAF6 TATA Binding Protein (TBP) Associated Factor 6 (TAF6) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex | Back alignment and domain information |
|---|
| >smart00428 H3 Histone H3 | Back alignment and domain information |
|---|
| >PF04719 TAFII28: hTAFII28-like protein conserved region; InterPro: IPR006809 The general transcription factor, TFIID, consists of the TATA-binding protein (TBP) associated with a series of TBP-associated factors (TAFs) that together participate in the assembly of the transcription preinitiation complex | Back alignment and domain information |
|---|
| >KOG3219 consensus Transcription initiation factor TFIID, subunit TAF11 [Transcription] | Back alignment and domain information |
|---|
| >KOG0869 consensus CCAAT-binding factor, subunit A (HAP3) [Transcription] | Back alignment and domain information |
|---|
| >smart00427 H2B Histone H2B | Back alignment and domain information |
|---|
| >PTZ00463 histone H2B; Provisional | Back alignment and domain information |
|---|
| >PF15511 CENP-T: Centromere kinetochore component CENP-T; PDB: 3B0D_T 3B0C_T 3VH5_T 3VH6_T | Back alignment and domain information |
|---|
| >KOG0871 consensus Class 2 transcription repressor NC2, beta subunit (Dr1) [Transcription] | Back alignment and domain information |
|---|
| >PF09415 CENP-X: CENP-S associating Centromere protein X; InterPro: IPR018552 Centromere protein X (CENP-X) is a component of the CENP-S complex | Back alignment and domain information |
|---|
| >PF03847 TFIID_20kDa: Transcription initiation factor TFIID subunit A; InterPro: IPR003228 Human transcription initiation factor TFIID is composed of the TATA-binding polypeptide (TBP) and at least 13 TBP-associated factors (TAFs) that collectively or individually are involved in activator-dependent transcription [] | Back alignment and domain information |
|---|
| >PF15630 CENP-S: Kinetochore component CENP-S; PDB: 4DRA_C 4DRB_H 3V9R_C | Back alignment and domain information |
|---|
| >KOG1658 consensus DNA polymerase epsilon, subunit C [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF02291 TFIID-31kDa: Transcription initiation factor IID, 31kD subunit; InterPro: IPR003162 Human transcription initiation factor TFIID is composed of the TATA-binding polypeptide (TBP) and at least 13 TBP-associated factors (TAFs) that collectively or individually are involved in activator-dependent transcription [] | Back alignment and domain information |
|---|
| >PLN00160 histone H3; Provisional | Back alignment and domain information |
|---|
| >PTZ00018 histone H3; Provisional | Back alignment and domain information |
|---|
| >PF07524 Bromo_TP: Bromodomain associated; InterPro: IPR006565 This bromodomain is found in eukaryotic transcription factors and PHD domain containing proteins (IPR001965 from INTERPRO) | Back alignment and domain information |
|---|
| >PLN00121 histone H3; Provisional | Back alignment and domain information |
|---|
| >KOG0870 consensus DNA polymerase epsilon, subunit D [Transcription] | Back alignment and domain information |
|---|
| >PLN00161 histone H3; Provisional | Back alignment and domain information |
|---|
| >KOG1744 consensus Histone H2B [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG1142 consensus Transcription initiation factor TFIID, subunit TAF12 (also component of histone acetyltransferase SAGA) [Transcription] | Back alignment and domain information |
|---|
| >PLN00163 histone H4; Provisional | Back alignment and domain information |
|---|
| >PF02269 TFIID-18kDa: Transcription initiation factor IID, 18kD subunit; InterPro: IPR003195 This family includes the Spt3 yeast transcription factors and the 18 kDa subunit from human transcription initiation factor IID (TFIID-18) | Back alignment and domain information |
|---|
| >cd07978 TAF13 The TATA Binding Protein (TBP) Associated Factor 13 (TAF13) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex | Back alignment and domain information |
|---|
| >KOG1745 consensus Histones H3 and H4 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >COG5094 TAF9 Transcription initiation factor TFIID, subunit TAF9 (also component of histone acetyltransferase SAGA) [Transcription] | Back alignment and domain information |
|---|
| >KOG3334 consensus Transcription initiation factor TFIID, subunit TAF9 (also component of histone acetyltransferase SAGA) [Transcription] | Back alignment and domain information |
|---|
| >COG5150 Class 2 transcription repressor NC2, beta subunit (Dr1) [Transcription] | Back alignment and domain information |
|---|
| >COG5251 TAF40 Transcription initiation factor TFIID, subunit TAF11 [Transcription] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 139 | ||||
| 1id3_C | 131 | Crystal Structure Of The Yeast Nucleosome Core Part | 2e-34 | ||
| 3c1b_C | 129 | The Effect Of H3 K79 Dimethylation And H4 K20 Trime | 2e-33 | ||
| 1m18_C | 129 | Ligand Binding Alters The Structure And Dynamics Of | 2e-33 | ||
| 1zbb_C | 129 | Structure Of The 4_601_167 Tetranucleosome Length = | 2e-33 | ||
| 2hio_A | 128 | Histone Octamer (Chicken), Chromosomal Protein Leng | 2e-33 | ||
| 1eqz_A | 129 | X-Ray Structure Of The Nucleosome Core Particle At | 2e-33 | ||
| 1s32_C | 119 | Molecular Recognition Of The Nucleosomal 'supergroo | 3e-33 | ||
| 1aoi_C | 116 | Complex Between Nucleosome Core Particle (H3,H4,H2a | 6e-33 | ||
| 3a6n_C | 133 | The Nucleosome Containing A Testis-Specific Histone | 7e-33 | ||
| 1kx3_C | 128 | X-Ray Structure Of The Nucleosome Core Particle, Nc | 1e-32 | ||
| 2cv5_C | 130 | Crystal Structure Of Human Nucleosome Core Particle | 1e-32 | ||
| 2nqb_C | 123 | Drosophila Nucleosome Structure Length = 123 | 1e-32 | ||
| 3kwq_C | 107 | Structural Characterization Of H3k56q Nucleosomes A | 2e-32 | ||
| 2f8n_K | 149 | 2.9 Angstrom X-Ray Structure Of Hybrid Macroh2a Nuc | 2e-32 | ||
| 1zla_C | 129 | X-Ray Structure Of A Kaposi's Sarcoma Herpesvirus L | 2e-32 | ||
| 2pyo_C | 120 | Drosophila Nucleosome Core Length = 120 | 3e-32 | ||
| 1hio_A | 95 | Histone Octamer (Chicken), Chromosomal Protein, Alp | 3e-29 | ||
| 1u35_C | 120 | Crystal Structure Of The Nucleosome Core Particle C | 7e-27 | ||
| 2xql_A | 91 | Fitting Of The H2a-H2b Histones In The Electron Mic | 9e-27 | ||
| 1f66_C | 128 | 2.6 A Crystal Structure Of A Nucleosome Core Partic | 3e-21 | ||
| 2jss_A | 192 | Nmr Structure Of Chaperone Chz1 Complexed With Hist | 5e-16 |
| >pdb|1ID3|C Chain C, Crystal Structure Of The Yeast Nucleosome Core Particle Reveals Fundamental Differences In Inter-Nucleosome Interactions Length = 131 | Back alignment and structure |
|
| >pdb|3C1B|C Chain C, The Effect Of H3 K79 Dimethylation And H4 K20 Trimethylation On Nucleosome And Chromatin Structure Length = 129 | Back alignment and structure |
| >pdb|1M18|C Chain C, Ligand Binding Alters The Structure And Dynamics Of Nucleosomal Dna Length = 129 | Back alignment and structure |
| >pdb|1ZBB|C Chain C, Structure Of The 4_601_167 Tetranucleosome Length = 129 | Back alignment and structure |
| >pdb|2HIO|A Chain A, Histone Octamer (Chicken), Chromosomal Protein Length = 128 | Back alignment and structure |
| >pdb|1EQZ|A Chain A, X-Ray Structure Of The Nucleosome Core Particle At 2.5 A Resolution Length = 129 | Back alignment and structure |
| >pdb|1S32|C Chain C, Molecular Recognition Of The Nucleosomal 'supergroove' Length = 119 | Back alignment and structure |
| >pdb|1AOI|C Chain C, Complex Between Nucleosome Core Particle (H3,H4,H2a,H2b) And 146 Bp Long Dna Fragment Length = 116 | Back alignment and structure |
| >pdb|3A6N|C Chain C, The Nucleosome Containing A Testis-Specific Histone Variant, Human H3t Length = 133 | Back alignment and structure |
| >pdb|1KX3|C Chain C, X-Ray Structure Of The Nucleosome Core Particle, Ncp146, At 2.0 A Resolution Length = 128 | Back alignment and structure |
| >pdb|2CV5|C Chain C, Crystal Structure Of Human Nucleosome Core Particle Length = 130 | Back alignment and structure |
| >pdb|2NQB|C Chain C, Drosophila Nucleosome Structure Length = 123 | Back alignment and structure |
| >pdb|3KWQ|C Chain C, Structural Characterization Of H3k56q Nucleosomes And Nucleo Arrays Length = 107 | Back alignment and structure |
| >pdb|2F8N|K Chain K, 2.9 Angstrom X-Ray Structure Of Hybrid Macroh2a Nucleosomes Length = 149 | Back alignment and structure |
| >pdb|1ZLA|C Chain C, X-Ray Structure Of A Kaposi's Sarcoma Herpesvirus Lana Peptide Bound To The Nucleosomal Core Length = 129 | Back alignment and structure |
| >pdb|2PYO|C Chain C, Drosophila Nucleosome Core Length = 120 | Back alignment and structure |
| >pdb|1HIO|A Chain A, Histone Octamer (Chicken), Chromosomal Protein, Alpha Carbons Only Length = 95 | Back alignment and structure |
| >pdb|1U35|C Chain C, Crystal Structure Of The Nucleosome Core Particle Containing The Histone Domain Of Macroh2a Length = 120 | Back alignment and structure |
| >pdb|2XQL|A Chain A, Fitting Of The H2a-H2b Histones In The Electron Microscopy Map Of The Complex Nucleoplasmin:h2a-H2b Histones (1:5). Length = 91 | Back alignment and structure |
| >pdb|1F66|C Chain C, 2.6 A Crystal Structure Of A Nucleosome Core Particle Containing The Variant Histone H2a.Z Length = 128 | Back alignment and structure |
| >pdb|2JSS|A Chain A, Nmr Structure Of Chaperone Chz1 Complexed With Histone H2a.Z-H2b Length = 192 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 139 | |||
| 1tzy_A | 129 | Histone H2A-IV; histone-fold, tetramer-dimer-dimer | 3e-45 | |
| 2f8n_G | 120 | Core histone macro-H2A.1; nucleosome, NCP, macroh2 | 6e-45 | |
| 2f8n_K | 149 | Histone H2A type 1; nucleosome, NCP, macroh2A, his | 7e-45 | |
| 1id3_C | 131 | Histone H2A.1; nucleosome core particle, chromatin | 4e-44 | |
| 2nqb_C | 123 | Histone H2A; nucleosome, NCP, chromatin, structura | 3e-43 | |
| 1f66_C | 128 | Histone H2A.Z; nucleosome, chromatin, histone vari | 6e-38 | |
| 2jss_A | 192 | Chimera of histone H2B.1 and histone H2A.Z; histon | 1e-27 | |
| 1jfi_A | 98 | Transcription regulator NC2 alpha chain; histone, | 3e-23 | |
| 1n1j_B | 97 | NF-YC; histone-like PAIR, DNA binding protein; 1.6 | 2e-11 | |
| 2byk_A | 140 | Chrac-16; nucleosome sliding, histone fold, DNA-bi | 4e-08 | |
| 3ksy_A | 1049 | SOS-1, SON of sevenless homolog 1; RAS, RAS activa | 4e-07 | |
| 1ku5_A | 70 | HPHA, archaeal histon; histone fold, DNA binding p | 1e-04 |
| >1tzy_A Histone H2A-IV; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_A 1hq3_A 2aro_A 2hio_A 3c9k_A 3azg_C 3a6n_C 3an2_C 3av1_C 3av2_C 3ayw_C 3aze_C 3azf_C 3afa_C 3azh_C 3azi_C 3azj_C 3azk_C 3azl_C 3azm_C ... Length = 129 | Back alignment and structure |
|---|
Score = 143 bits (360), Expect = 3e-45
Identities = 85/122 (69%), Positives = 99/122 (81%)
Query: 6 STKGGRGKPKSTKSISRSHKAGLQFPVGRIARFLKAGKYADRVGAGAPVYLSAVLEYLAA 65
S +G +G K+ SRS +AGLQFPVGR+ R L+ G YA+RVGAGAPVYL+AVLEYL A
Sbjct: 2 SGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTA 61
Query: 66 EVLELAGNAARDNKKNRIVPRHIQLAVRNDEELSKLLGTVTIANGGVLPNIHQNLLPRKM 125
E+LELAGNAARDNKK RI+PRH+QLA+RNDEEL+KLLG VTIA GGVLPNI LLP+K
Sbjct: 62 EILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKT 121
Query: 126 GK 127
Sbjct: 122 DS 123
|
| >2f8n_G Core histone macro-H2A.1; nucleosome, NCP, macroh2A, histone variant, chromatin, X- RAY structure, crystallography, structural protein/DNA complex; 2.90A {Homo sapiens} SCOP: a.22.1.1 PDB: 1u35_C Length = 120 | Back alignment and structure |
|---|
| >2f8n_K Histone H2A type 1; nucleosome, NCP, macroh2A, histone variant, chromatin, X- RAY structure, crystallography, structural protein/DNA complex; 2.90A {Mus musculus} SCOP: a.22.1.1 Length = 149 | Back alignment and structure |
|---|
| >1id3_C Histone H2A.1; nucleosome core particle, chromatin, protein/DNA interaction, nucleoprotein, supercoiled DNA; 3.10A {Saccharomyces cerevisiae} SCOP: a.22.1.1 Length = 131 | Back alignment and structure |
|---|
| >2nqb_C Histone H2A; nucleosome, NCP, chromatin, structural protein/DNA complex; 2.30A {Drosophila melanogaster} PDB: 2pyo_C* Length = 123 | Back alignment and structure |
|---|
| >1f66_C Histone H2A.Z; nucleosome, chromatin, histone variant, protein DNA interaction, nucleoprotein, supercoiled DNA, complex (nucleosome core/DNA); 2.60A {Homo sapiens} SCOP: a.22.1.1 Length = 128 | Back alignment and structure |
|---|
| >2jss_A Chimera of histone H2B.1 and histone H2A.Z; histone/chaperone complex, intrinsically unfolded protein, chaperone/structural protein complex; NMR {Saccharomyces cerevisiae} SCOP: a.22.1.1 a.22.1.1 Length = 192 | Back alignment and structure |
|---|
| >1jfi_A Transcription regulator NC2 alpha chain; histone, H2A/H2B, tata-DNA, transcription initiation, NC2, negative cofactor, structural genomics, PSI; 2.62A {Homo sapiens} SCOP: a.22.1.3 Length = 98 | Back alignment and structure |
|---|
| >1n1j_B NF-YC; histone-like PAIR, DNA binding protein; 1.67A {Homo sapiens} SCOP: a.22.1.3 Length = 97 | Back alignment and structure |
|---|
| >2byk_A Chrac-16; nucleosome sliding, histone fold, DNA-binding protein; 2.4A {Drosophila melanogaster} SCOP: a.22.1.3 PDB: 2bym_A Length = 140 | Back alignment and structure |
|---|
| >3ksy_A SOS-1, SON of sevenless homolog 1; RAS, RAS activator, disease mutation, guanine-nucleotide releasing factor, signaling protein; 3.18A {Homo sapiens} PDB: 1xd4_A 1xdv_A 1q9c_A Length = 1049 | Back alignment and structure |
|---|
| >1ku5_A HPHA, archaeal histon; histone fold, DNA binding protein; 2.30A {Pyrococcus horikoshii} SCOP: a.22.1.2 Length = 70 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 139 | |||
| 1id3_C | 131 | Histone H2A.1; nucleosome core particle, chromatin | 100.0 | |
| 1tzy_A | 129 | Histone H2A-IV; histone-fold, tetramer-dimer-dimer | 100.0 | |
| 2nqb_C | 123 | Histone H2A; nucleosome, NCP, chromatin, structura | 100.0 | |
| 2f8n_G | 120 | Core histone macro-H2A.1; nucleosome, NCP, macroh2 | 100.0 | |
| 2f8n_K | 149 | Histone H2A type 1; nucleosome, NCP, macroh2A, his | 100.0 | |
| 1f66_C | 128 | Histone H2A.Z; nucleosome, chromatin, histone vari | 100.0 | |
| 2jss_A | 192 | Chimera of histone H2B.1 and histone H2A.Z; histon | 100.0 | |
| 3ksy_A | 1049 | SOS-1, SON of sevenless homolog 1; RAS, RAS activa | 99.9 | |
| 1jfi_A | 98 | Transcription regulator NC2 alpha chain; histone, | 99.9 | |
| 1n1j_B | 97 | NF-YC; histone-like PAIR, DNA binding protein; 1.6 | 99.81 | |
| 4g92_C | 119 | HAPE; transcription factor, nucleosome, minor groo | 99.79 | |
| 1tzy_D | 103 | Histone H4-VI; histone-fold, tetramer-dimer-dimer, | 99.78 | |
| 2yfw_B | 103 | Histone H4, H4; cell cycle, kinetochore, centromer | 99.77 | |
| 2byk_A | 140 | Chrac-16; nucleosome sliding, histone fold, DNA-bi | 99.73 | |
| 1f1e_A | 154 | Histone fold protein; archaeal histone protein, DN | 99.45 | |
| 1id3_B | 102 | Histone H4; nucleosome core particle, chromatin, p | 99.41 | |
| 1b67_A | 68 | Protein (histone HMFA); DNA binding protein; 1.48A | 99.29 | |
| 1ku5_A | 70 | HPHA, archaeal histon; histone fold, DNA binding p | 99.28 | |
| 1n1j_A | 93 | NF-YB; histone-like PAIR, DNA binding protein; 1.6 | 99.09 | |
| 3b0c_W | 76 | CENP-W, centromere protein W; histone fold, DNA bi | 98.96 | |
| 2hue_C | 84 | Histone H4; mini beta sheet, elongated beta sandwh | 98.95 | |
| 2byk_B | 128 | Chrac-14; nucleosome sliding, histone fold, DNA-bi | 98.94 | |
| 1taf_B | 70 | TFIID TBP associated factor 62; transcription init | 98.9 | |
| 1f1e_A | 154 | Histone fold protein; archaeal histone protein, DN | 98.82 | |
| 3b0c_T | 111 | CENP-T, centromere protein T; histone fold, DNA bi | 98.62 | |
| 1taf_A | 68 | TFIID TBP associated factor 42; transcription init | 98.57 | |
| 1jfi_B | 179 | DR1 protein, transcription regulator NC2 beta chai | 98.51 | |
| 3v9r_A | 90 | MHF1, uncharacterized protein YOL086W-A; histone f | 98.34 | |
| 2hue_B | 77 | Histone H3; mini beta sheet, elongated beta sandwh | 98.22 | |
| 4dra_A | 113 | Centromere protein S; DNA binding complex, DNA dam | 98.22 | |
| 3nqj_A | 82 | Histone H3-like centromeric protein A; alpha helix | 98.21 | |
| 3b0b_B | 107 | CENP-S, centromere protein S; histone fold, DNA bi | 98.16 | |
| 2yfv_A | 100 | Histone H3-like centromeric protein CSE4; cell cyc | 98.02 | |
| 3vh5_A | 140 | CENP-S; histone fold, chromosome segregation, DNA | 98.01 | |
| 3r45_A | 156 | Histone H3-like centromeric protein A; histone fol | 98.0 | |
| 3nqu_A | 140 | Histone H3-like centromeric protein A; alpha helix | 98.0 | |
| 1tzy_B | 126 | Histone H2B; histone-fold, tetramer-dimer-dimer, D | 97.96 | |
| 1tzy_C | 136 | Histone H3; histone-fold, tetramer-dimer-dimer, DN | 97.91 | |
| 2ly8_A | 121 | Budding yeast chaperone SCM3; centromere protein, | 97.87 | |
| 2nqb_D | 123 | Histone H2B; nucleosome, NCP, chromatin, structura | 97.74 | |
| 2l5a_A | 235 | Histone H3-like centromeric protein CSE4, protein | 97.71 | |
| 1bh9_B | 89 | TAFII28; histone fold, tata binding protein, trans | 97.32 | |
| 2jss_A | 192 | Chimera of histone H2B.1 and histone H2A.Z; histon | 97.22 | |
| 4dra_E | 84 | Centromere protein X; DNA binding complex, DNA dam | 96.9 | |
| 3b0b_C | 81 | CENP-X, centromere protein X; histone fold, DNA bi | 96.74 | |
| 1h3o_B | 76 | Transcription initiation factor TFIID 20/15 kDa su | 95.96 | |
| 2l5a_A | 235 | Histone H3-like centromeric protein CSE4, protein | 93.45 | |
| 1wwi_A | 148 | Hypothetical protein TTHA1479; structural genomics | 89.52 | |
| 1k6k_A | 143 | ATP-dependent CLP protease ATP-binding subunit CLP | 88.08 | |
| 1khy_A | 148 | CLPB protein; alpha helix, chaperone; 1.95A {Esche | 83.72 | |
| 3v9r_B | 88 | MHF2, uncharacterized protein YDL160C-A; histone f | 83.43 | |
| 3fes_A | 145 | ATP-dependent CLP endopeptidase; alpha-helical bun | 81.99 | |
| 2y1q_A | 150 | CLPC N-domain, negative regulator of genetic compe | 81.69 | |
| 1r4v_A | 171 | Hypothetical protein AQ_328; structural genomics, | 81.2 | |
| 3fh2_A | 146 | Probable ATP-dependent protease (heat shock prote; | 80.52 |
| >1id3_C Histone H2A.1; nucleosome core particle, chromatin, protein/DNA interaction, nucleoprotein, supercoiled DNA; 3.10A {Saccharomyces cerevisiae} SCOP: a.22.1.1 | Back alignment and structure |
|---|
Probab=100.00 E-value=4.2e-48 Score=286.42 Aligned_cols=128 Identities=71% Similarity=1.112 Sum_probs=107.5
Q ss_pred CCCCCCCCCCCCcCcccccCcccchHHHHHHHHhCCCccccCCchHHHHHHHHHHHHHHHHHHHHHHHhhcCCCccchhh
Q 032523 8 KGGRGKPKSTKSISRSHKAGLQFPVGRIARFLKAGKYADRVGAGAPVYLSAVLEYLAAEVLELAGNAARDNKKNRIVPRH 87 (139)
Q Consensus 8 ~~~~~~~~~~~~~s~ssragL~fPvsri~R~Lk~~~~~~RVs~~A~vyLaAvLEyL~~EILelAg~~A~~~~~krItP~h 87 (139)
++|||+.++++.+|+|+|++|+|||+||+|||+++++++||+++|+|||+||||||++||||+|+|+|+++++++|+|+|
T Consensus 4 ~~~~~~~~~~~~~srS~ragLqfPV~rI~R~Lk~~~~a~RVs~~A~VyLaAvLEyL~aEIlelAgn~A~~~k~krItp~h 83 (131)
T 1id3_C 4 KGGKAGSAAKASQSRSAKAGLTFPVGRVHRLLRRGNYAQRIGSGAPVYLTAVLEYLAAEILELAGNAARDNKKTRIIPRH 83 (131)
T ss_dssp ------------CCTTGGGTCSSCHHHHHHHHHTTCSCSEECSSHHHHHHHHHHHHHHHHHHHHHHHHHHTTCSEECHHH
T ss_pred CCCCCCCCCCCCCCccccCCeecCHHHHHHHHHccccccccchhhHHHHHHHHHHHHHHHHHHHHHHHhhcCCceEcHHH
Confidence 56777777889999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHhhhCcHHHHhhhcCceecCCccCCcccccccccccCCCCccCCccCCCC
Q 032523 88 IQLAVRNDEELSKLLGTVTIANGGVLPNIHQNLLPRKMGKGREDIGSASQEF 139 (139)
Q Consensus 88 I~~AI~nD~EL~~L~~~~~Ia~ggv~P~i~~~l~~~k~~~~~~~~~~~~~~~ 139 (139)
|++||+||+|||+||+++||++|||+|+||++|++++.+++ ..++|++
T Consensus 84 I~lAI~nDeEL~~Ll~~vtIa~ggvlP~i~~~l~~k~~~~~----~~~~~~~ 131 (131)
T 1id3_C 84 LQLAIRNDDELNKLLGNVTIAQGGVLPNIHQNLLPKKSAKA----TKASQEL 131 (131)
T ss_dssp HHHHHHTCHHHHHHTTTEEETTCCCCCCCCGGGSCCSCCSC----C------
T ss_pred HHHHHhccHHHHHHhcCceecCCccCCCccHHHcCcccccc----ccccccC
Confidence 99999999999999999999999999999999999998766 2556653
|
| >1tzy_A Histone H2A-IV; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_A 1hq3_A 2aro_A 2hio_A 3c9k_A 3azg_C 3a6n_C 3an2_C 3av1_C 3av2_C 3ayw_C 3aze_C 3azf_C 3afa_C 3azh_C 3azi_C 3azj_C 3azk_C 3azl_C 3azm_C ... | Back alignment and structure |
|---|
| >2nqb_C Histone H2A; nucleosome, NCP, chromatin, structural protein/DNA complex; 2.30A {Drosophila melanogaster} PDB: 2pyo_C* | Back alignment and structure |
|---|
| >2f8n_G Core histone macro-H2A.1; nucleosome, NCP, macroh2A, histone variant, chromatin, X- RAY structure, crystallography, structural protein/DNA complex; 2.90A {Homo sapiens} SCOP: a.22.1.1 PDB: 1u35_C | Back alignment and structure |
|---|
| >2f8n_K Histone H2A type 1; nucleosome, NCP, macroh2A, histone variant, chromatin, X- RAY structure, crystallography, structural protein/DNA complex; 2.90A {Mus musculus} SCOP: a.22.1.1 | Back alignment and structure |
|---|
| >1f66_C Histone H2A.Z; nucleosome, chromatin, histone variant, protein DNA interaction, nucleoprotein, supercoiled DNA, complex (nucleosome core/DNA); 2.60A {Homo sapiens} SCOP: a.22.1.1 | Back alignment and structure |
|---|
| >2jss_A Chimera of histone H2B.1 and histone H2A.Z; histone/chaperone complex, intrinsically unfolded protein, chaperone/structural protein complex; NMR {Saccharomyces cerevisiae} SCOP: a.22.1.1 a.22.1.1 | Back alignment and structure |
|---|
| >3ksy_A SOS-1, SON of sevenless homolog 1; RAS, RAS activator, disease mutation, guanine-nucleotide releasing factor, signaling protein; 3.18A {Homo sapiens} PDB: 1xd4_A 1xdv_A 1q9c_A | Back alignment and structure |
|---|
| >1jfi_A Transcription regulator NC2 alpha chain; histone, H2A/H2B, tata-DNA, transcription initiation, NC2, negative cofactor, structural genomics, PSI; 2.62A {Homo sapiens} SCOP: a.22.1.3 | Back alignment and structure |
|---|
| >1n1j_B NF-YC; histone-like PAIR, DNA binding protein; 1.67A {Homo sapiens} SCOP: a.22.1.3 | Back alignment and structure |
|---|
| >4g92_C HAPE; transcription factor, nucleosome, minor groove binding, CCAA complex, histone fold motif, specific binding to the ccaat- nucleus; HET: DNA; 1.80A {Aspergillus nidulans} PDB: 4g91_C* | Back alignment and structure |
|---|
| >1tzy_D Histone H4-VI; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1f66_B 1eqz_D 1hq3_D 1u35_B 2aro_D 2cv5_B* 2f8n_B 3nqu_B 3r45_B 3azg_B 3a6n_B 3an2_B 3av1_B 3av2_B 3ayw_B 3aze_B 3azf_B 3afa_B 3azh_B 3azk_B ... | Back alignment and structure |
|---|
| >2yfw_B Histone H4, H4; cell cycle, kinetochore, centromere, histone chaperone, BUDD; 2.60A {Kluyveromyces lactis nrrl y-1140} | Back alignment and structure |
|---|
| >2byk_A Chrac-16; nucleosome sliding, histone fold, DNA-binding protein; 2.4A {Drosophila melanogaster} SCOP: a.22.1.3 PDB: 2bym_A | Back alignment and structure |
|---|
| >1f1e_A Histone fold protein; archaeal histone protein, DNA binding protein; HET: MSE; 1.37A {Methanopyrus kandleri} SCOP: a.22.1.2 | Back alignment and structure |
|---|
| >1id3_B Histone H4; nucleosome core particle, chromatin, protein/DNA interaction, nucleoprotein, supercoiled DNA; 3.10A {Saccharomyces cerevisiae} SCOP: a.22.1.1 | Back alignment and structure |
|---|
| >1b67_A Protein (histone HMFA); DNA binding protein; 1.48A {Methanothermus fervidus} SCOP: a.22.1.2 PDB: 1hta_A 1a7w_A 1b6w_A 1bfm_A | Back alignment and structure |
|---|
| >1ku5_A HPHA, archaeal histon; histone fold, DNA binding protein; 2.30A {Pyrococcus horikoshii} SCOP: a.22.1.2 | Back alignment and structure |
|---|
| >1n1j_A NF-YB; histone-like PAIR, DNA binding protein; 1.67A {Homo sapiens} SCOP: a.22.1.3 | Back alignment and structure |
|---|
| >3b0c_W CENP-W, centromere protein W; histone fold, DNA binding, DNA binding protein; HET: CIT; 2.20A {Gallus gallus} PDB: 3b0d_W* 3vh5_W 3vh6_W | Back alignment and structure |
|---|
| >2hue_C Histone H4; mini beta sheet, elongated beta sandwhich, DNA binding prote; 1.70A {Xenopus laevis} SCOP: a.22.1.1 PDB: 3nqj_B 1aoi_B 3kwq_B* 1hio_D 2yfv_B | Back alignment and structure |
|---|
| >2byk_B Chrac-14; nucleosome sliding, histone fold, DNA-binding protein; 2.4A {Drosophila melanogaster} SCOP: a.22.1.3 PDB: 2bym_B | Back alignment and structure |
|---|
| >1taf_B TFIID TBP associated factor 62; transcription initiation, histone fold, complex (TWO transcr factors); 2.00A {Drosophila melanogaster} SCOP: a.22.1.3 | Back alignment and structure |
|---|
| >1f1e_A Histone fold protein; archaeal histone protein, DNA binding protein; HET: MSE; 1.37A {Methanopyrus kandleri} SCOP: a.22.1.2 | Back alignment and structure |
|---|
| >3b0c_T CENP-T, centromere protein T; histone fold, DNA binding, DNA binding protein; HET: CIT; 2.20A {Gallus gallus} PDB: 3b0d_T* 3vh5_T 3vh6_T | Back alignment and structure |
|---|
| >1taf_A TFIID TBP associated factor 42; transcription initiation, histone fold, complex (TWO transcr factors); 2.00A {Drosophila melanogaster} SCOP: a.22.1.3 | Back alignment and structure |
|---|
| >1jfi_B DR1 protein, transcription regulator NC2 beta chain; histone, H2A/H2B, tata-DNA, transcription initiation, NC2, negative cofactor, structural genomics, PSI; 2.62A {Homo sapiens} SCOP: a.22.1.3 | Back alignment and structure |
|---|
| >3v9r_A MHF1, uncharacterized protein YOL086W-A; histone fold, fanconi anemia, DNA repair, DNA BI protein; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2hue_B Histone H3; mini beta sheet, elongated beta sandwhich, DNA binding prote; 1.70A {Xenopus laevis} | Back alignment and structure |
|---|
| >4dra_A Centromere protein S; DNA binding complex, DNA damage repair, histone-fold, DNA BI protein; 2.41A {Homo sapiens} PDB: 4drb_A | Back alignment and structure |
|---|
| >3nqj_A Histone H3-like centromeric protein A; alpha helix, histone fold, centromere, DNA binding protein; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3b0b_B CENP-S, centromere protein S; histone fold, DNA binding, DNA, nucleus, DNA binding protein; 2.15A {Gallus gallus} | Back alignment and structure |
|---|
| >2yfv_A Histone H3-like centromeric protein CSE4; cell cycle, kinetochore, centromere, histone chaperone, BUDD; 2.32A {Kluyveromyces lactis nrrl y-1140} PDB: 2yfw_A | Back alignment and structure |
|---|
| >3vh5_A CENP-S; histone fold, chromosome segregation, DNA binding, nucleus, binding protein; 2.40A {Gallus gallus} PDB: 3vh6_A | Back alignment and structure |
|---|
| >3r45_A Histone H3-like centromeric protein A; histone fold, centromere, CENP-A, histone chaperone, hjurp; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3nqu_A Histone H3-like centromeric protein A; alpha helix, histone fold, centromere, DNA binding protein; 2.50A {Homo sapiens} PDB: 3an2_A | Back alignment and structure |
|---|
| >1tzy_B Histone H2B; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_B 1hq3_B 2aro_B 2hio_B 3c9k_B 3azg_D 3a6n_D 3an2_D 3av1_D 3av2_D 3ayw_D 3aze_D 3azf_D 3afa_D 3azh_D 3azi_D 3azj_D 3azk_D 3azl_D 3azm_D ... | Back alignment and structure |
|---|
| >1tzy_C Histone H3; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_C 1hq3_C 2aro_C 2f8n_A 2hio_C 3av1_A 3lel_A 3afa_A 3azi_A 3azj_A 3azk_A 3azl_A 3azm_A 3azn_A 2cv5_A* 1u35_A* 2nqb_A 2io5_B 2pyo_A* 3c9k_C ... | Back alignment and structure |
|---|
| >2ly8_A Budding yeast chaperone SCM3; centromere protein, CENH3 variants, partially unfolded; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2nqb_D Histone H2B; nucleosome, NCP, chromatin, structural protein/DNA complex; 2.30A {Drosophila melanogaster} PDB: 2pyo_D* | Back alignment and structure |
|---|
| >2l5a_A Histone H3-like centromeric protein CSE4, protein histone H4; A single chain of CSE4+SCM3+H4, fusion protein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1bh9_B TAFII28; histone fold, tata binding protein, transcription regulation complex; HET: PMB; 2.60A {Homo sapiens} SCOP: a.22.1.3 PDB: 1bh8_B* | Back alignment and structure |
|---|
| >2jss_A Chimera of histone H2B.1 and histone H2A.Z; histone/chaperone complex, intrinsically unfolded protein, chaperone/structural protein complex; NMR {Saccharomyces cerevisiae} SCOP: a.22.1.1 a.22.1.1 | Back alignment and structure |
|---|
| >4dra_E Centromere protein X; DNA binding complex, DNA damage repair, histone-fold, DNA BI protein; 2.41A {Homo sapiens} PDB: 4drb_J | Back alignment and structure |
|---|
| >3b0b_C CENP-X, centromere protein X; histone fold, DNA binding, DNA, nucleus, DNA binding protein; 2.15A {Gallus gallus} PDB: 3vh5_D 3vh6_D | Back alignment and structure |
|---|
| >1h3o_B Transcription initiation factor TFIID 20/15 kDa subunits; transcription/TBP-associated factors, TBP-associated factors; 2.3A {Homo sapiens} SCOP: a.22.1.3 | Back alignment and structure |
|---|
| >2l5a_A Histone H3-like centromeric protein CSE4, protein histone H4; A single chain of CSE4+SCM3+H4, fusion protein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1wwi_A Hypothetical protein TTHA1479; structural genomics, unknown function, riken structural genomics/proteomics initiative, RSGI; 1.58A {Thermus thermophilus HB8} SCOP: a.22.1.4 PDB: 1wws_A | Back alignment and structure |
|---|
| >1k6k_A ATP-dependent CLP protease ATP-binding subunit CLPA; chaperone, ATPase, adaptor binding, X-RAY, structure, N-domain, hydrolase; 1.80A {Escherichia coli} SCOP: a.174.1.1 PDB: 1r6c_X 1r6o_A* 1r6q_A* 1mg9_B* 1lzw_B* 1mbx_A* 1mbv_A 1mbu_A* | Back alignment and structure |
|---|
| >1khy_A CLPB protein; alpha helix, chaperone; 1.95A {Escherichia coli} SCOP: a.174.1.1 | Back alignment and structure |
|---|
| >3v9r_B MHF2, uncharacterized protein YDL160C-A; histone fold, fanconi anemia, DNA repair, DNA BI protein; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3fes_A ATP-dependent CLP endopeptidase; alpha-helical bundles, structural genomics, PSI-2, protein S initiative; HET: PG4 EPE; 1.82A {Clostridium difficile} | Back alignment and structure |
|---|
| >2y1q_A CLPC N-domain, negative regulator of genetic competence CLPC/MEC; transcription, proteolysis; 1.50A {Bacillus subtilis} PDB: 2y1r_A* 2k77_A | Back alignment and structure |
|---|
| >1r4v_A Hypothetical protein AQ_328; structural genomics, all-alpha, histon fold, PSI, protein ST initiative, midwest center for structural genomics; HET: MSE; 1.90A {Aquifex aeolicus} SCOP: a.22.1.4 | Back alignment and structure |
|---|
| >3fh2_A Probable ATP-dependent protease (heat shock prote; struct genomics, PSI2, MCSG, protein structure initiative; 1.60A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 139 | ||||
| d1u35c1 | 106 | a.22.1.1 (C:814-919) macro-H2A.1, histone domain { | 6e-56 | |
| d1tzya_ | 106 | a.22.1.1 (A:) Histone H2A {Chicken (Gallus gallus) | 2e-55 | |
| d1f66c_ | 103 | a.22.1.1 (C:) Histone H2A {Human (Homo sapiens), v | 2e-47 | |
| d1q9ca_ | 172 | a.22.1.3 (A:) Histone domain of Son of sevenless p | 1e-40 | |
| d1jfia_ | 66 | a.22.1.3 (A:) Negative cofactor 2, NC2, alpha chai | 2e-22 | |
| d1n1jb_ | 78 | a.22.1.3 (B:) Nuclear transcription factor Y subun | 2e-21 | |
| d1f1ea_ | 151 | a.22.1.2 (A:) Archaeal histone {Archaeon Methanopy | 1e-12 | |
| d1f1ea_ | 151 | a.22.1.2 (A:) Archaeal histone {Archaeon Methanopy | 3e-09 | |
| d1htaa_ | 68 | a.22.1.2 (A:) Archaeal histone {Archaeon Methanoth | 7e-05 | |
| d1ku5a_ | 66 | a.22.1.2 (A:) Archaeal histone {Archaeon (Pyrococc | 3e-04 | |
| d1n1ja_ | 87 | a.22.1.3 (A:) Nuclear transcription factor Y subun | 0.002 |
| >d1u35c1 a.22.1.1 (C:814-919) macro-H2A.1, histone domain {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Histone-fold superfamily: Histone-fold family: Nucleosome core histones domain: macro-H2A.1, histone domain species: Human (Homo sapiens) [TaxId: 9606]
Score = 168 bits (426), Expect = 6e-56
Identities = 71/104 (68%), Positives = 84/104 (80%)
Query: 21 SRSHKAGLQFPVGRIARFLKAGKYADRVGAGAPVYLSAVLEYLAAEVLELAGNAARDNKK 80
SRS KAG+ FPVGR+ R++K G R+G GAPVY++AVLEYL AE+LELA NAARDNKK
Sbjct: 3 SRSAKAGVIFPVGRMLRYIKKGHPKYRIGVGAPVYMAAVLEYLTAEILELAVNAARDNKK 62
Query: 81 NRIVPRHIQLAVRNDEELSKLLGTVTIANGGVLPNIHQNLLPRK 124
R+ PRHI LAV NDEEL++LL VTIA+GGVLPNIH LL +K
Sbjct: 63 GRVTPRHILLAVANDEELNQLLKGVTIASGGVLPNIHPELLAKK 106
|
| >d1tzya_ a.22.1.1 (A:) Histone H2A {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} Length = 106 | Back information, alignment and structure |
|---|
| >d1f66c_ a.22.1.1 (C:) Histone H2A {Human (Homo sapiens), variant H2A.Z [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1q9ca_ a.22.1.3 (A:) Histone domain of Son of sevenless protein {Human (Homo sapiens) [TaxId: 9606]} Length = 172 | Back information, alignment and structure |
|---|
| >d1jfia_ a.22.1.3 (A:) Negative cofactor 2, NC2, alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 66 | Back information, alignment and structure |
|---|
| >d1n1jb_ a.22.1.3 (B:) Nuclear transcription factor Y subunit gamma (Nf-Yc2) {Human (Homo sapiens) [TaxId: 9606]} Length = 78 | Back information, alignment and structure |
|---|
| >d1f1ea_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanopyrus kandleri [TaxId: 2320]} Length = 151 | Back information, alignment and structure |
|---|
| >d1f1ea_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanopyrus kandleri [TaxId: 2320]} Length = 151 | Back information, alignment and structure |
|---|
| >d1htaa_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanothermus fervidus, histone A [TaxId: 2180]} Length = 68 | Back information, alignment and structure |
|---|
| >d1ku5a_ a.22.1.2 (A:) Archaeal histone {Archaeon (Pyrococcus horikoshii) [TaxId: 53953]} Length = 66 | Back information, alignment and structure |
|---|
| >d1n1ja_ a.22.1.3 (A:) Nuclear transcription factor Y subunit beta (Nf-Yb3) {Human (Homo sapiens) [TaxId: 9606]} Length = 87 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 139 | |||
| d1tzya_ | 106 | Histone H2A {Chicken (Gallus gallus), erythrocytes | 100.0 | |
| d1u35c1 | 106 | macro-H2A.1, histone domain {Human (Homo sapiens) | 100.0 | |
| d1f66c_ | 103 | Histone H2A {Human (Homo sapiens), variant H2A.Z [ | 100.0 | |
| d1q9ca_ | 172 | Histone domain of Son of sevenless protein {Human | 99.95 | |
| d1jfia_ | 66 | Negative cofactor 2, NC2, alpha chain {Human (Homo | 99.69 | |
| d1n1jb_ | 78 | Nuclear transcription factor Y subunit gamma (Nf-Y | 99.61 | |
| d1f1ea_ | 151 | Archaeal histone {Archaeon Methanopyrus kandleri [ | 99.42 | |
| d1ku5a_ | 66 | Archaeal histone {Archaeon (Pyrococcus horikoshii) | 99.29 | |
| d1htaa_ | 68 | Archaeal histone {Archaeon Methanothermus fervidus | 99.28 | |
| d1n1ja_ | 87 | Nuclear transcription factor Y subunit beta (Nf-Yb | 99.18 | |
| d1jfib_ | 135 | Negative cofactor 2, NC2, beta chain {Human (Homo | 98.96 | |
| d1f1ea_ | 151 | Archaeal histone {Archaeon Methanopyrus kandleri [ | 98.89 | |
| d2byka1 | 72 | Chrac-16 {Fruit fly (Drosophila melanogaster) [Tax | 98.81 | |
| d2huec1 | 82 | Histone H4 {African clawed frog (Xenopus laevis) [ | 98.7 | |
| d2bykb1 | 89 | Chrac-14 {Fruit fly (Drosophila melanogaster) [Tax | 98.66 | |
| d1tzyc_ | 95 | Histone H3 {Chicken (Gallus gallus), erythrocytes | 97.33 | |
| d1tafb_ | 70 | TAF(II)62 {Fruit fly (Drosophila melanogaster) [Ta | 97.32 | |
| d1tzyb_ | 92 | Histone H2B {Chicken (Gallus gallus), erythrocytes | 97.26 | |
| d1bh9b_ | 89 | TAF(II)28 {Human (Homo sapiens) [TaxId: 9606]} | 97.26 | |
| d1tafa_ | 68 | TAF(II)42 {Fruit fly (Drosophila melanogaster) [Ta | 95.98 | |
| d1h3ob_ | 74 | TAF(II)-20, (TAF(II)-15, hTAF12), histone fold dom | 95.54 | |
| d1k6ka_ | 142 | N-terminal, ClpS-binding domain of ClpA, an Hsp100 | 91.43 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 90.0 | |
| d1wwia1 | 148 | Hypothetical protein TTHA1479 {Thermus thermophilu | 89.54 | |
| d1khya_ | 139 | N-terminal domain of ClpB (heat shock protein F84. | 87.87 | |
| d1qvra1 | 145 | N-terminal domain of ClpB (heat shock protein F84. | 87.68 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 84.04 |
| >d1tzya_ a.22.1.1 (A:) Histone H2A {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Histone-fold superfamily: Histone-fold family: Nucleosome core histones domain: Histone H2A species: Chicken (Gallus gallus), erythrocytes [TaxId: 9031]
Probab=100.00 E-value=2.8e-46 Score=265.86 Aligned_cols=106 Identities=76% Similarity=1.203 Sum_probs=103.7
Q ss_pred CCcCcccccCcccchHHHHHHHHhCCCccccCCchHHHHHHHHHHHHHHHHHHHHHHHhhcCCCccchhhHHHhhhCcHH
Q 032523 18 KSISRSHKAGLQFPVGRIARFLKAGKYADRVGAGAPVYLSAVLEYLAAEVLELAGNAARDNKKNRIVPRHIQLAVRNDEE 97 (139)
Q Consensus 18 ~~~s~ssragL~fPvsri~R~Lk~~~~~~RVs~~A~vyLaAvLEyL~~EILelAg~~A~~~~~krItP~hI~~AI~nD~E 97 (139)
+.+|||+||||+|||+||+|+|++++|++||+.+|||||+||||||++||||+|||+|+++++++|+|+||++||+||+|
T Consensus 1 k~~Srs~rAgL~FpV~rv~r~Lk~~~~~~rv~~~apVylaAVLEYLtaEiLELAgn~a~~~k~~rItPrhi~lAirnDee 80 (106)
T d1tzya_ 1 KAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEE 80 (106)
T ss_dssp CCCCHHHHHTCSSCHHHHHHHHHHTTSSSEECTHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCSEECHHHHHHHHHTSHH
T ss_pred CCccccccCCccCChHHHHHHHHcCccccccCCCchHHHHHHHHHHHHHHHHHhhHHHHhcCCceecchhhhhcccCHHH
Confidence 46899999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHhhhcCceecCCccCCccccccccc
Q 032523 98 LSKLLGTVTIANGGVLPNIHQNLLPR 123 (139)
Q Consensus 98 L~~L~~~~~Ia~ggv~P~i~~~l~~~ 123 (139)
|+.||+++||++|||+|+||++|+||
T Consensus 81 L~~L~~~vtI~~GGv~P~Ih~~Llpk 106 (106)
T d1tzya_ 81 LNKLLGKVTIAQGGVLPNIQAVLLPK 106 (106)
T ss_dssp HHHHTTTEEETTCCCCCCCCGGGSCC
T ss_pred HHHHHcCCeecCCCccCccCHhhcCC
Confidence 99999999999999999999999986
|
| >d1u35c1 a.22.1.1 (C:814-919) macro-H2A.1, histone domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f66c_ a.22.1.1 (C:) Histone H2A {Human (Homo sapiens), variant H2A.Z [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q9ca_ a.22.1.3 (A:) Histone domain of Son of sevenless protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jfia_ a.22.1.3 (A:) Negative cofactor 2, NC2, alpha chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n1jb_ a.22.1.3 (B:) Nuclear transcription factor Y subunit gamma (Nf-Yc2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f1ea_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanopyrus kandleri [TaxId: 2320]} | Back information, alignment and structure |
|---|
| >d1ku5a_ a.22.1.2 (A:) Archaeal histone {Archaeon (Pyrococcus horikoshii) [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1htaa_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanothermus fervidus, histone A [TaxId: 2180]} | Back information, alignment and structure |
|---|
| >d1n1ja_ a.22.1.3 (A:) Nuclear transcription factor Y subunit beta (Nf-Yb3) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jfib_ a.22.1.3 (B:) Negative cofactor 2, NC2, beta chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f1ea_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanopyrus kandleri [TaxId: 2320]} | Back information, alignment and structure |
|---|
| >d2byka1 a.22.1.3 (A:29-100) Chrac-16 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2huec1 a.22.1.1 (C:20-101) Histone H4 {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d2bykb1 a.22.1.3 (B:11-99) Chrac-14 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1tzyc_ a.22.1.1 (C:) Histone H3 {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1tafb_ a.22.1.3 (B:) TAF(II)62 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1tzyb_ a.22.1.1 (B:) Histone H2B {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1bh9b_ a.22.1.3 (B:) TAF(II)28 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tafa_ a.22.1.3 (A:) TAF(II)42 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1h3ob_ a.22.1.3 (B:) TAF(II)-20, (TAF(II)-15, hTAF12), histone fold domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k6ka_ a.174.1.1 (A:) N-terminal, ClpS-binding domain of ClpA, an Hsp100 chaperone {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1wwia1 a.22.1.4 (A:1-148) Hypothetical protein TTHA1479 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1khya_ a.174.1.1 (A:) N-terminal domain of ClpB (heat shock protein F84.1) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qvra1 a.174.1.1 (A:4-148) N-terminal domain of ClpB (heat shock protein F84.1) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|