Citrus Sinensis ID: 032565


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------14
MVVNLLFHICLDYGVVSVHHVGILCENLERSLEFYQNILGLEINEARPHDKLPYRGAWLWVGAEMIHLMELPNPDPLSGRPEHGGRDRHTCIAIRDVSKLKMILDKAGISYTLSKSGRPAIFTRDPDANALEFTQVDG
cEEEEEEccccccccEEEcEEEEEcccHHHHHHHHHHccccEEEcEEcccccccEEEEEEcccEEEEEEEccccccccccccccccccEEEEEEccHHHHHHHHHHcccEEEEccccccEEEEEcccccEEEEEEEcc
ccHHHHHHHHHHcccccEEEEEEEEccHHHHHHHHHHHHccEEEHccHHHcccccHccccccccEEEEEcccccccccccccHccccccEEEEEccHHHHHHHHHHcccEEEEEccccEEEEEcccccccEEEEEEcc
MVVNLLFHICLDYGVVSVHHVGILCENLERSLEFYQNILGLeinearphdklpyrgaWLWVGAEMIhlmelpnpdplsgrpehggrdrhtciaIRDVSKLKMILDKAGisytlsksgrpaiftrdpdanaleftqvdg
MVVNLLFHICLDYGVVSVHHVGILCENLERSLEFYQNILGLEINEARPHDKLPYRGAWLWVGAEMIHLMELPNPDPLSGRPEHGGRDRHTCIAIRDVSKLKMILDKAGIsytlsksgrpaiftrdpdanaleftqvdg
MVVNLLFHICLDYGVVSVHHVGILCENLERSLEFYQNILGLEINEARPHDKLPYRGAWLWVGAEMIHLMELPNPDPLSGRPEHGGRDRHTCIAIRDVSKLKMILDKAGISYTLSKSGRPAIFTRDPDANALEFTQVDG
*VVNLLFHICLDYGVVSVHHVGILCENLERSLEFYQNILGLEINEARPHDKLPYRGAWLWVGAEMIHLMEL*****************HTCIAIRDVSKLKMILDKAGISYTLS************************
MVVNLL*HICLDYGVVSVHHVGILCENLERSLEFYQNILGLEINEARPHDKLPYRGAWLWVGAEMIHLMELPNPDPLSGRPEHGGRDRHTCIAIRDVSKLKMILDKAGISYTLSKSGRPAIFTRDPDANALEFTQVD*
MVVNLLFHICLDYGVVSVHHVGILCENLERSLEFYQNILGLEINEARPHDKLPYRGAWLWVGAEMIHLMELPNPDPLS********DRHTCIAIRDVSKLKMILDKAGISYTLSKSGRPAIFTRDPDANALEFTQVDG
MVVNLLFHICLDYGVVSVHHVGILCENLERSLEFYQNILGLEINEARPHDKLPYRGAWLWVGAEMIHLMELPNPDPLSGRPEHGGRDRHTCIAIRDVSKLKMILDKAGISYTLSKSGRPAIFTRDPDANALEFTQVDG
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVVNLLFHICLDYGVVSVHHVGILCENLERSLEFYQNILGLEINEARPHDKLPYRGAWLWVGAEMIHLMELPNPDPLSGRPEHGGRDRHTCIAIRDVSKLKMILDKAGISYTLSKSGRPAIFTRDPDANALEFTQVDG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query138 2.2.26 [Sep-21-2011]
P45871128 Uncharacterized protein Y yes no 0.833 0.898 0.305 2e-07
Q96PE7176 Methylmalonyl-CoA epimera yes no 0.746 0.585 0.304 4e-05
Q9D1I5178 Methylmalonyl-CoA epimera yes no 0.804 0.623 0.256 0.0003
Q2KIZ3175 Methylmalonyl-CoA epimera yes no 0.775 0.611 0.264 0.0009
P52096129 Uncharacterized protein Y N/A no 0.876 0.937 0.251 0.0009
>sp|P45871|YWKD_BACSU Uncharacterized protein YwkD OS=Bacillus subtilis (strain 168) GN=ywkD PE=4 SV=1 Back     alignment and function desciption
 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/121 (30%), Positives = 55/121 (45%), Gaps = 6/121 (4%)

Query: 17  SVHHVGILCENLERSLEFYQNILGLE-INEARPHDKLPYRGAWLWVGAEMIHLMELPNPD 75
           S+HH+ I+C + E+S  FY + LG + I E    ++  Y+      G+ +I L   P+P 
Sbjct: 5   SIHHIAIICSDYEKSKAFYVHKLGFQVIQETYREERGSYKLDLSLNGSYVIELFSFPDPP 64

Query: 76  PLSGRPEHGGRDRHTCIAIRDVSKLKMILDKAGISY----TLSKSGRPAIFTRDPDANAL 131
               RPE  G  RH    +  + K    L + GI      T   +G+   F  DPD   L
Sbjct: 65  ERQTRPEAAGL-RHLAFTVGSLDKAVQELHEKGIETEPIRTDPLTGKRFTFFFDPDQLPL 123

Query: 132 E 132
           E
Sbjct: 124 E 124





Bacillus subtilis (strain 168) (taxid: 224308)
>sp|Q96PE7|MCEE_HUMAN Methylmalonyl-CoA epimerase, mitochondrial OS=Homo sapiens GN=MCEE PE=1 SV=1 Back     alignment and function description
>sp|Q9D1I5|MCEE_MOUSE Methylmalonyl-CoA epimerase, mitochondrial OS=Mus musculus GN=Mcee PE=2 SV=1 Back     alignment and function description
>sp|Q2KIZ3|MCEE_BOVIN Methylmalonyl-CoA epimerase, mitochondrial OS=Bos taurus GN=MCEE PE=2 SV=1 Back     alignment and function description
>sp|P52096|YAER_ECOLI Uncharacterized protein YaeR OS=Escherichia coli (strain K12) GN=yaeR PE=4 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query138
388493084200 unknown [Lotus japonicus] 0.913 0.63 0.920 7e-66
15242020197 Lactoylglutathione lyase / glyoxalase I 0.905 0.634 0.928 3e-65
297796591196 lactoylglutathione lyase family protein 0.905 0.637 0.928 4e-65
226495911193 glyoxalase/bleomycin resistance protein/ 0.905 0.647 0.92 2e-64
449489903206 PREDICTED: uncharacterized LOC101203815 0.920 0.616 0.913 4e-64
449452528175 PREDICTED: uncharacterized protein LOC10 0.920 0.725 0.913 5e-64
359807103206 uncharacterized protein LOC100805881 [Gl 0.920 0.616 0.897 8e-64
356547897209 PREDICTED: uncharacterized protein LOC10 0.913 0.602 0.896 1e-63
358347730129 Glyoxalase/bleomycin resistance protein/ 0.905 0.968 0.904 2e-63
414869121226 TPA: glyoxalase/bleomycin resistance pro 0.934 0.570 0.837 1e-60
>gi|388493084|gb|AFK34608.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
 Score =  254 bits (649), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 116/126 (92%), Positives = 124/126 (98%)

Query: 12  DYGVVSVHHVGILCENLERSLEFYQNILGLEINEARPHDKLPYRGAWLWVGAEMIHLMEL 71
           DYGVVS+HHVGILCENLER L+FYQN+LGLEINEARPHDKLPYRGAWLWVG+EMIHLMEL
Sbjct: 74  DYGVVSIHHVGILCENLERPLDFYQNVLGLEINEARPHDKLPYRGAWLWVGSEMIHLMEL 133

Query: 72  PNPDPLSGRPEHGGRDRHTCIAIRDVSKLKMILDKAGISYTLSKSGRPAIFTRDPDANAL 131
           PNPDPL+GRP+HGGRDRHTCIAIRDVSKLK ILDKAGISYTLS+SGRPAIFTRDPDANAL
Sbjct: 134 PNPDPLTGRPQHGGRDRHTCIAIRDVSKLKAILDKAGISYTLSRSGRPAIFTRDPDANAL 193

Query: 132 EFTQVD 137
           EFTQ+D
Sbjct: 194 EFTQID 199




Source: Lotus japonicus

Species: Lotus japonicus

Genus: Lotus

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|15242020|ref|NP_200514.1| Lactoylglutathione lyase / glyoxalase I family protein [Arabidopsis thaliana] gi|8777444|dbj|BAA97034.1| unnamed protein product [Arabidopsis thaliana] gi|21594695|gb|AAM66034.1| unknown [Arabidopsis thaliana] gi|88193792|gb|ABD42985.1| At5g57040 [Arabidopsis thaliana] gi|110742698|dbj|BAE99260.1| hypothetical protein [Arabidopsis thaliana] gi|332009455|gb|AED96838.1| Lactoylglutathione lyase / glyoxalase I family protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297796591|ref|XP_002866180.1| lactoylglutathione lyase family protein [Arabidopsis lyrata subsp. lyrata] gi|297312015|gb|EFH42439.1| lactoylglutathione lyase family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|226495911|ref|NP_001147026.1| glyoxalase/bleomycin resistance protein/dioxygenase [Zea mays] gi|195606588|gb|ACG25124.1| glyoxalase/bleomycin resistance protein/dioxygenase [Zea mays] Back     alignment and taxonomy information
>gi|449489903|ref|XP_004158454.1| PREDICTED: uncharacterized LOC101203815 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449452528|ref|XP_004144011.1| PREDICTED: uncharacterized protein LOC101203815 [Cucumis sativus] Back     alignment and taxonomy information
>gi|359807103|ref|NP_001241602.1| uncharacterized protein LOC100805881 [Glycine max] gi|255638057|gb|ACU19343.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|356547897|ref|XP_003542341.1| PREDICTED: uncharacterized protein LOC100788142 [Glycine max] Back     alignment and taxonomy information
>gi|358347730|ref|XP_003637907.1| Glyoxalase/bleomycin resistance protein/dioxygenase [Medicago truncatula] gi|355503842|gb|AES85045.1| Glyoxalase/bleomycin resistance protein/dioxygenase [Medicago truncatula] Back     alignment and taxonomy information
>gi|414869121|tpg|DAA47678.1| TPA: glyoxalase/bleomycin resistance protein/dioxygenase [Zea mays] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query138
TAIR|locus:2164600197 AT5G57040 "AT5G57040" [Arabido 0.905 0.634 0.928 4.8e-62
TAIR|locus:2016254167 GLYI7 "AT1G80160" [Arabidopsis 0.876 0.724 0.304 1.9e-12
TAIR|locus:2037728174 GLYI4 "AT1G15380" [Arabidopsis 0.876 0.695 0.304 1e-11
TIGR_CMR|BA_0607128 BA_0607 "glyoxylase family pro 0.847 0.914 0.344 1.3e-11
TAIR|locus:2057522184 GLYI8 "AT2G28420" [Arabidopsis 0.840 0.630 0.296 7.6e-09
UNIPROTKB|Q9KL58127 VC_A0890 "Glyoxylase I family 0.833 0.905 0.296 1.1e-07
TIGR_CMR|VC_A0890127 VC_A0890 "glyoxylase I family 0.833 0.905 0.296 1.1e-07
UNIPROTKB|E2REA1189 MCEE "Uncharacterized protein" 0.797 0.582 0.285 2.3e-07
TIGR_CMR|CPS_2825128 CPS_2825 "glyoxylase family pr 0.847 0.914 0.284 3.8e-07
UNIPROTKB|Q96PE7176 MCEE "Methylmalonyl-CoA epimer 0.797 0.625 0.293 6.1e-07
TAIR|locus:2164600 AT5G57040 "AT5G57040" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 634 (228.2 bits), Expect = 4.8e-62, P = 4.8e-62
 Identities = 116/125 (92%), Positives = 121/125 (96%)

Query:    12 DYGVVSVHHVGILCENLERSLEFYQNILGLEINEARPHDKLPYRGAWLWVGAEMIHLMEL 71
             DYGVV VHHVG+LCENLERSLEFYQNILGLEINEARPHDKLPYRGAWLWVG+EMIHLMEL
Sbjct:    73 DYGVVGVHHVGLLCENLERSLEFYQNILGLEINEARPHDKLPYRGAWLWVGSEMIHLMEL 132

Query:    72 PNPDPLSGRPEHGGRDRHTCIAIRDVSKLKMILDKAGISYTLSKSGRPAIFTRDPDANAL 131
             PNPDPL+GRPEHGGRDRH CIAIRDVS LK ILDKAGI+YT+SKSGRPAIFTRDPDANAL
Sbjct:   133 PNPDPLTGRPEHGGRDRHACIAIRDVSNLKEILDKAGIAYTMSKSGRPAIFTRDPDANAL 192

Query:   132 EFTQV 136
             EFTQV
Sbjct:   193 EFTQV 197




GO:0003824 "catalytic activity" evidence=ISS
GO:0008152 "metabolic process" evidence=ISS
GO:0009507 "chloroplast" evidence=IDA
TAIR|locus:2016254 GLYI7 "AT1G80160" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2037728 GLYI4 "AT1G15380" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TIGR_CMR|BA_0607 BA_0607 "glyoxylase family protein" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
TAIR|locus:2057522 GLYI8 "AT2G28420" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q9KL58 VC_A0890 "Glyoxylase I family protein" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms
TIGR_CMR|VC_A0890 VC_A0890 "glyoxylase I family protein" [Vibrio cholerae O1 biovar El Tor (taxid:686)] Back     alignment and assigned GO terms
UNIPROTKB|E2REA1 MCEE "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_2825 CPS_2825 "glyoxylase family protein" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
UNIPROTKB|Q96PE7 MCEE "Methylmalonyl-CoA epimerase, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P45871YWKD_BACSUNo assigned EC number0.30570.83330.8984yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.13.11.39LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
AT5G57040
lactoylglutathione lyase family protein / glyoxalase I family protein; lactoylglutathione lyase family protein / glyoxalase I family protein; FUNCTIONS IN- catalytic activity; INVOLVED IN- metabolic process; LOCATED IN- chloroplast; EXPRESSED IN- 23 plant structures; EXPRESSED DURING- 15 growth stages; CONTAINS InterPro DOMAIN/s- Glyoxalase/bleomycin resistance protein/dioxygenase (InterPro-IPR004360); BEST Arabidopsis thaliana protein match is- lactoylglutathione lyase family protein / glyoxalase I family protein (TAIR-AT1G80160.1); Has 744 Blast hits to 744 proteins in 277 species- A [...] (197 aa)
(Arabidopsis thaliana)
Predicted Functional Partners:
AT2G45870
unknown protein; unknown protein; FUNCTIONS IN- molecular_function unknown; INVOLVED IN- biolog [...] (410 aa)
       0.883
AT1G65230
unknown protein; unknown protein; FUNCTIONS IN- molecular_function unknown; INVOLVED IN- biolog [...] (286 aa)
      0.832
AT2G12280
ligase, putative; ligase, putative; FUNCTIONS IN- formate-tetrahydrofolate ligase activity, lig [...] (90 aa)
       0.825
AT2G12200
ligase, putative; ligase, putative; FUNCTIONS IN- formate-tetrahydrofolate ligase activity, lig [...] (63 aa)
       0.825
AT2G42750
DNAJ heat shock N-terminal domain-containing protein; DNAJ heat shock N-terminal domain-contain [...] (344 aa)
      0.785
AT5G03880
electron carrier; electron carrier; FUNCTIONS IN- electron carrier activity; INVOLVED IN- cell [...] (339 aa)
       0.698
AT5G37360
unknown protein; unknown protein; FUNCTIONS IN- molecular_function unknown; INVOLVED IN- biolog [...] (309 aa)
       0.690
MSRB1
MSRB1 (methionine sulfoxide reductase B 1); peptide-methionine-(S)-S-oxide reductase; methionin [...] (202 aa)
       0.681
AT1G52870
peroxisomal membrane protein-related; peroxisomal membrane protein-related; FUNCTIONS IN- molec [...] (366 aa)
       0.677
AT5G57345
unknown protein; unknown protein; FUNCTIONS IN- molecular_function unknown; INVOLVED IN- biolog [...] (188 aa)
       0.667

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query138
cd07245114 cd07245, Glo_EDI_BRP_like_9, This conserved domain 1e-33
pfam00903120 pfam00903, Glyoxalase, Glyoxalase/Bleomycin resist 2e-12
cd08352125 cd08352, Glo_EDI_BRP_like_1, This conserved domain 1e-11
cd06587110 cd06587, Glo_EDI_BRP_like, This domain superfamily 2e-11
cd08354122 cd08354, Glo_EDI_BRP_like_13, This conserved domai 5e-11
COG0346138 COG0346, GloA, Lactoylglutathione lyase and relate 3e-10
PRK11478129 PRK11478, PRK11478, putative lyase; Provisional 3e-08
pfam12681109 pfam12681, Glyoxalase_2, Glyoxalase-like domain 1e-07
cd08346126 cd08346, PcpA_N_like, N-terminal domain of Sphingo 3e-07
cd07253125 cd07253, Glo_EDI_BRP_like_2, This conserved domain 5e-06
cd07233121 cd07233, Glyoxalase_I, Glyoxalase I catalyzes the 1e-05
TIGR03081128 TIGR03081, metmalonyl_epim, methylmalonyl-CoA epim 2e-05
pfam13669110 pfam13669, Glyoxalase_4, Glyoxalase/Bleomycin resi 3e-05
cd07255125 cd07255, Glo_EDI_BRP_like_12, This conserved domai 8e-04
cd07249128 cd07249, MMCE, Methylmalonyl-CoA epimerase (MMCE) 0.001
>gnl|CDD|176669 cd07245, Glo_EDI_BRP_like_9, This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
 Score =  113 bits (285), Expect = 1e-33
 Identities = 44/120 (36%), Positives = 59/120 (49%), Gaps = 10/120 (8%)

Query: 18  VHHVGILCENLERSLEFYQNILGLEINEARPHDKLPYRGAWLWVG-AEMIHLMELPNPDP 76
           + HV +   +LE S  FY ++LGLE     P     + GAWL+ G    +HL+E   PD 
Sbjct: 1   LDHVALRVPDLEASRAFYTDVLGLEEGPRPPF---LFPGAWLYAGDGPQLHLIEEDPPDA 57

Query: 77  LSGRPEHGGRDRHTCIAIRDVSKLKMILDKAGISYTLSKS---GRPAIFTRDPDANALEF 133
           L   PE  GRD H    + D+   +  L  AG+ YT S     G   +F RDPD N +E 
Sbjct: 58  L---PEGPGRDDHIAFRVDDLDAFRARLKAAGVPYTESDVPGDGVRQLFVRDPDGNRIEL 114


This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases. Length = 114

>gnl|CDD|216182 pfam00903, Glyoxalase, Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily Back     alignment and domain information
>gnl|CDD|211358 cd08352, Glo_EDI_BRP_like_1, This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>gnl|CDD|211348 cd06587, Glo_EDI_BRP_like, This domain superfamily is found in a variety of structurally related metalloproteins, including the type I extradiol dioxygenases, glyoxalase I and a group of antibiotic resistance proteins Back     alignment and domain information
>gnl|CDD|176702 cd08354, Glo_EDI_BRP_like_13, This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>gnl|CDD|223423 COG0346, GloA, Lactoylglutathione lyase and related lyases [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|183156 PRK11478, PRK11478, putative lyase; Provisional Back     alignment and domain information
>gnl|CDD|221708 pfam12681, Glyoxalase_2, Glyoxalase-like domain Back     alignment and domain information
>gnl|CDD|211356 cd08346, PcpA_N_like, N-terminal domain of Sphingobium chlorophenolicum 2,6-dichloro-p-hydroquinone 1,2-dioxygenase (PcpA), and similar proteins Back     alignment and domain information
>gnl|CDD|176676 cd07253, Glo_EDI_BRP_like_2, This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>gnl|CDD|176659 cd07233, Glyoxalase_I, Glyoxalase I catalyzes the isomerization of the hemithioacetal, formed by a 2-oxoaldehyde and glutathione, to S-D-lactoylglutathione Back     alignment and domain information
>gnl|CDD|213772 TIGR03081, metmalonyl_epim, methylmalonyl-CoA epimerase Back     alignment and domain information
>gnl|CDD|222305 pfam13669, Glyoxalase_4, Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily Back     alignment and domain information
>gnl|CDD|211352 cd07255, Glo_EDI_BRP_like_12, This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>gnl|CDD|211350 cd07249, MMCE, Methylmalonyl-CoA epimerase (MMCE) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 138
cd08353142 Glo_EDI_BRP_like_7 This conserved domain belongs t 99.92
PRK11478129 putative lyase; Provisional 99.92
PLN02367233 lactoylglutathione lyase 99.91
PLN03042185 Lactoylglutathione lyase; Provisional 99.91
cd08352125 Glo_EDI_BRP_like_1 This conserved domain belongs t 99.91
cd07241125 Glo_EDI_BRP_like_3 This conserved domain belongs t 99.9
cd08342136 HPPD_N_like N-terminal domain of 4-hydroxyphenylpy 99.9
TIGR03645162 glyox_marine lactoylglutathione lyase family prote 99.9
PRK04101139 fosfomycin resistance protein FosB; Provisional 99.9
cd08364131 FosX FosX, a fosfomycin resistance protein, cataly 99.9
TIGR00068150 glyox_I lactoylglutathione lyase. Glyoxylase I is 99.9
TIGR03081128 metmalonyl_epim methylmalonyl-CoA epimerase. Membe 99.89
cd08347157 PcpA_C_like C-terminal domain of Sphingobium chlor 99.89
cd07243143 2_3_CTD_C C-terminal domain of catechol 2,3-dioxyg 99.89
cd07233121 Glyoxalase_I Glyoxalase I catalyzes the isomerizat 99.89
cd07253125 Glo_EDI_BRP_like_2 This conserved domain belongs t 99.89
cd07245114 Glo_EDI_BRP_like_9 This conserved domain belongs t 99.89
cd08363131 FosB FosB, a fosfomycin resistance protein, cataly 99.88
cd07255125 Glo_EDI_BRP_like_12 This conserved domain belongs 99.88
PLN02300 286 lactoylglutathione lyase 99.88
cd09011120 Glo_EDI_BRP_like_23 This conserved domain belongs 99.88
cd09014166 BphC-JF8_C_like C-terminal, catalytic, domain of B 99.88
PRK10291129 glyoxalase I; Provisional 99.88
cd08355122 Glo_EDI_BRP_like_14 This conserved domain belongs 99.88
cd09013121 BphC-JF8_N_like N-terminal, non-catalytic, domain 99.88
cd08361124 PpCmtC_N N-terminal domain of 2,3-dihydroxy-p-cuma 99.87
cd07267113 THT_Oxygenase_N N-terminal domain of 2,4,5-trihydr 99.87
cd07252120 BphC1-RGP6_N_like N-terminal domain of 2,3-dihydro 99.87
cd07247114 SgaA_N_like N-terminal domain of Streptomyces gris 99.87
cd07257153 THT_oxygenase_C The C-terminal domain of 2,4,5-Tri 99.87
cd07265122 2_3_CTD_N N-terminal domain of catechol 2,3-dioxyg 99.87
cd07263119 Glo_EDI_BRP_like_16 This conserved domain belongs 99.87
cd08351123 ChaP_like ChaP, an enzyme involved in the biosynth 99.87
cd07242128 Glo_EDI_BRP_like_6 This conserved domain belongs t 99.87
cd07244121 FosA FosA, a Fosfomycin resistance protein, cataly 99.87
cd07240117 ED_TypeI_classII_N N-terminal domain of type I, cl 99.86
cd08346126 PcpA_N_like N-terminal domain of Sphingobium chlor 99.86
cd08348134 BphC2-C3-RGP6_C_like The single-domain 2,3-dihydro 99.86
cd08345113 Fosfomycin_RP Fosfomycin resistant protein; inhibi 99.86
cd08362120 BphC5-RrK37_N_like N-terminal, non-catalytic, doma 99.86
cd07249128 MMCE Methylmalonyl-CoA epimerase (MMCE). MMCE, als 99.86
cd07264125 Glo_EDI_BRP_like_15 This conserved domain belongs 99.86
cd08359119 Glo_EDI_BRP_like_22 This conserved domain belongs 99.86
cd07246122 Glo_EDI_BRP_like_8 This conserved domain belongs t 99.86
cd08360134 MhqB_like_C C-terminal domain of Burkholderia sp. 99.86
cd07237154 BphC1-RGP6_C_like C-terminal domain of 2,3-dihydro 99.86
PF00903128 Glyoxalase: Glyoxalase/Bleomycin resistance protei 99.85
PRK06724128 hypothetical protein; Provisional 99.85
cd07256161 HPCD_C_class_II C-terminal domain of 3,4-dihydroxy 99.85
cd07239144 BphC5-RK37_C_like C-terminal, catalytic, domain of 99.84
cd07266121 HPCD_N_class_II N-terminal domain of 3,4-dihydroxy 99.84
cd08354122 Glo_EDI_BRP_like_13 This conserved domain belongs 99.84
cd08350120 BLMT_like BLMT, a bleomycin resistance protein enc 99.84
cd08343131 ED_TypeI_classII_C C-terminal domain of type I, cl 99.84
cd08349112 BLMA_like Bleomycin binding protein (BLMA) and sim 99.83
cd08357125 Glo_EDI_BRP_like_18 This conserved domain belongs 99.83
cd08358127 Glo_EDI_BRP_like_21 This conserved domain belongs 99.83
cd07261114 Glo_EDI_BRP_like_11 This conserved domain belongs 99.83
cd07254120 Glo_EDI_BRP_like_20 This conserved domain belongs 99.83
cd07235122 MRD Mitomycin C resistance protein (MRD). Mitomyci 99.83
cd09012124 Glo_EDI_BRP_like_24 This conserved domain belongs 99.83
PF12681108 Glyoxalase_2: Glyoxalase-like domain; PDB: 3G12_B 99.82
cd08356113 Glo_EDI_BRP_like_17 This conserved domain belongs 99.82
cd07238112 Glo_EDI_BRP_like_5 This conserved domain belongs t 99.82
TIGR03211303 catechol_2_3 catechol 2,3 dioxygenase. Members of 99.82
cd07258141 PpCmtC_C C-terminal domain of 2,3-dihydroxy-p-cuma 99.82
cd06587112 Glo_EDI_BRP_like This domain superfamily is found 99.81
cd08344112 MhqB_like_N N-terminal domain of MhqB, a type I ex 99.81
cd07262123 Glo_EDI_BRP_like_19 This conserved domain belongs 99.81
cd07251121 Glo_EDI_BRP_like_10 This conserved domain belongs 99.8
TIGR03213 286 23dbph12diox 2,3-dihydroxybiphenyl 1,2-dioxygenase 99.8
TIGR02295294 HpaD 3,4-dihydroxyphenylacetate 2,3-dioxygenase. T 99.79
TIGR03213286 23dbph12diox 2,3-dihydroxybiphenyl 1,2-dioxygenase 99.79
TIGR02295 294 HpaD 3,4-dihydroxyphenylacetate 2,3-dioxygenase. T 99.78
TIGR03211 303 catechol_2_3 catechol 2,3 dioxygenase. Members of 99.76
PF13669109 Glyoxalase_4: Glyoxalase/Bleomycin resistance prot 99.74
COG2514 265 Predicted ring-cleavage extradiol dioxygenase [Gen 99.73
KOG2944170 consensus Glyoxalase [Carbohydrate transport and m 99.72
PLN02300286 lactoylglutathione lyase 99.72
COG3324127 Predicted enzyme related to lactoylglutathione lya 99.69
COG3607133 Predicted lactoylglutathione lyase [General functi 99.64
COG3565138 Predicted dioxygenase of extradiol dioxygenase fam 99.59
cd07250191 HPPD_C_like C-terminal domain of 4-hydroxyphenylpy 99.54
cd06588128 PhnB_like Escherichia coli PhnB and similar protei 99.52
COG2764136 PhnB Uncharacterized protein conserved in bacteria 99.46
TIGR01263353 4HPPD 4-hydroxyphenylpyruvate dioxygenase. This pr 99.41
TIGR01263 353 4HPPD 4-hydroxyphenylpyruvate dioxygenase. This pr 99.4
COG0346138 GloA Lactoylglutathione lyase and related lyases [ 99.35
PRK01037357 trmD tRNA (guanine-N(1)-)-methyltransferase/unknow 99.26
PLN02875398 4-hydroxyphenylpyruvate dioxygenase 99.23
KOG2943 299 consensus Predicted glyoxalase [Carbohydrate trans 99.17
PF13468175 Glyoxalase_3: Glyoxalase-like domain; PDB: 3P8A_B. 99.08
KOG2943299 consensus Predicted glyoxalase [Carbohydrate trans 99.07
PRK10148147 hypothetical protein; Provisional 99.03
COG2514265 Predicted ring-cleavage extradiol dioxygenase [Gen 99.01
KOG0638 381 consensus 4-hydroxyphenylpyruvate dioxygenase [Ami 98.79
PF14696139 Glyoxalase_5: Hydroxyphenylpyruvate dioxygenase, H 98.75
PF14506125 CppA_N: CppA N-terminal; PDB: 3E0R_D. 98.73
PLN02875 398 4-hydroxyphenylpyruvate dioxygenase 98.64
COG3185363 4-hydroxyphenylpyruvate dioxygenase and related he 98.54
COG3185 363 4-hydroxyphenylpyruvate dioxygenase and related he 98.02
PF15067236 FAM124: FAM124 family 97.86
PF06983116 3-dmu-9_3-mt: 3-demethylubiquinone-9 3-methyltrans 97.86
KOG0638381 consensus 4-hydroxyphenylpyruvate dioxygenase [Ami 97.81
PF13669109 Glyoxalase_4: Glyoxalase/Bleomycin resistance prot 97.28
PF14507101 CppA_C: CppA C-terminal; PDB: 3E0R_D. 96.89
KOG2944170 consensus Glyoxalase [Carbohydrate transport and m 96.27
cd08353142 Glo_EDI_BRP_like_7 This conserved domain belongs t 95.87
cd08342136 HPPD_N_like N-terminal domain of 4-hydroxyphenylpy 95.26
PLN02367233 lactoylglutathione lyase 95.17
PF13468 175 Glyoxalase_3: Glyoxalase-like domain; PDB: 3P8A_B. 94.75
cd07249128 MMCE Methylmalonyl-CoA epimerase (MMCE). MMCE, als 94.73
cd08347 157 PcpA_C_like C-terminal domain of Sphingobium chlor 94.42
cd08352125 Glo_EDI_BRP_like_1 This conserved domain belongs t 94.39
PRK11478129 putative lyase; Provisional 94.39
PF1367083 PepSY_2: Peptidase propeptide and YPEB domain This 94.01
TIGR03645162 glyox_marine lactoylglutathione lyase family prote 93.79
cd07242128 Glo_EDI_BRP_like_6 This conserved domain belongs t 93.59
cd08346126 PcpA_N_like N-terminal domain of Sphingobium chlor 93.57
cd07245114 Glo_EDI_BRP_like_9 This conserved domain belongs t 93.26
PLN03042185 Lactoylglutathione lyase; Provisional 93.21
cd07235122 MRD Mitomycin C resistance protein (MRD). Mitomyci 93.2
COG3865151 Uncharacterized protein conserved in bacteria [Fun 93.02
cd06587112 Glo_EDI_BRP_like This domain superfamily is found 92.57
PF06185185 YecM: YecM protein; InterPro: IPR010393 This famil 92.54
cd08348134 BphC2-C3-RGP6_C_like The single-domain 2,3-dihydro 92.29
cd07241125 Glo_EDI_BRP_like_3 This conserved domain belongs t 92.24
PRK10291129 glyoxalase I; Provisional 91.47
cd07255125 Glo_EDI_BRP_like_12 This conserved domain belongs 91.0
TIGR03081128 metmalonyl_epim methylmalonyl-CoA epimerase. Membe 90.7
cd07252120 BphC1-RGP6_N_like N-terminal domain of 2,3-dihydro 90.39
cd07263119 Glo_EDI_BRP_like_16 This conserved domain belongs 89.57
cd07250 191 HPPD_C_like C-terminal domain of 4-hydroxyphenylpy 89.55
TIGR00068150 glyox_I lactoylglutathione lyase. Glyoxylase I is 89.05
cd08344112 MhqB_like_N N-terminal domain of MhqB, a type I ex 88.94
PRK11700187 hypothetical protein; Provisional 88.61
PF12681108 Glyoxalase_2: Glyoxalase-like domain; PDB: 3G12_B 88.46
cd07268149 Glo_EDI_BRP_like_4 This conserved domain belongs t 88.32
cd07262123 Glo_EDI_BRP_like_19 This conserved domain belongs 88.1
PF00903128 Glyoxalase: Glyoxalase/Bleomycin resistance protei 88.02
cd07233121 Glyoxalase_I Glyoxalase I catalyzes the isomerizat 88.01
cd07253125 Glo_EDI_BRP_like_2 This conserved domain belongs t 87.88
cd08359119 Glo_EDI_BRP_like_22 This conserved domain belongs 86.66
cd07240117 ED_TypeI_classII_N N-terminal domain of type I, cl 86.61
cd08360134 MhqB_like_C C-terminal domain of Burkholderia sp. 85.91
cd0488372 ACT_AcuB C-terminal ACT domain of the Bacillus sub 84.94
cd08363131 FosB FosB, a fosfomycin resistance protein, cataly 83.03
cd09012124 Glo_EDI_BRP_like_24 This conserved domain belongs 82.67
cd07257153 THT_oxygenase_C The C-terminal domain of 2,4,5-Tri 82.4
cd0488265 ACT_Bt0572_2 C-terminal ACT domain of a novel prot 82.13
cd07238112 Glo_EDI_BRP_like_5 This conserved domain belongs t 80.86
cd07265122 2_3_CTD_N N-terminal domain of catechol 2,3-dioxyg 80.22
cd08361124 PpCmtC_N N-terminal domain of 2,3-dihydroxy-p-cuma 80.1
PF07063302 DUF1338: Domain of unknown function (DUF1338); Int 80.05
>cd08353 Glo_EDI_BRP_like_7 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
Probab=99.92  E-value=1.3e-23  Score=129.79  Aligned_cols=121  Identities=21%  Similarity=0.351  Sum_probs=90.2

Q ss_pred             eeeeeeEEEEeCCHHHHHHHHHHhhCCeeeccCCCC-----------CCCeeEEEEEe--CCeEEEEeecCCCCCCCC--
Q 032565           15 VVSVHHVGILCENLERSLEFYQNILGLEINEARPHD-----------KLPYRGAWLWV--GAEMIHLMELPNPDPLSG--   79 (138)
Q Consensus        15 ~~~l~hi~l~v~d~~~a~~fy~~~lg~~~~~~~~~~-----------~~~~~~~~~~~--~~~~~~l~~~~~~~~~~~--   79 (138)
                      +.+++||+|.|+|++++++||++ |||+........           ......+++..  ++..++|+....+.....  
T Consensus         1 ~~~i~Hi~i~v~Dl~~s~~FY~~-LG~~~~~~~~~~~~~~~~~~g~~~~~~~~~~l~~~~g~~~iel~~~~~~~~~~~~~   79 (142)
T cd08353           1 VSRMDNVGIVVRDLEAAIAFFLE-LGLELEGRAEIEGEWADRVTGLDGVRVEIAMLRTPDGHSRLELSKFHHPAVIADHR   79 (142)
T ss_pred             CceeeeEEEEeCCHHHHHHHHHH-cCCEEccccccChHHHHHhcCCCCceEEEEEEeCCCCCceEEEEEecCCCCcCcCC
Confidence            46899999999999999999998 999876543211           11223344543  456888887544322211  


Q ss_pred             -CCCCCCCCceEEEEECCHHHHHHHHHHCCCeEEec----CCCccEEEEECCCCCeEEEEee
Q 032565           80 -RPEHGGRDRHTCIAIRDVSKLKMILDKAGISYTLS----KSGRPAIFTRDPDANALEFTQV  136 (138)
Q Consensus        80 -~~~~~~~~~hi~~~v~d~~~~~~~l~~~g~~~~~~----~~~~~~~~~~DPdG~~~e~~~~  136 (138)
                       ....+.+..|+||.|+|+++++++|+++|+++..+    .++.+.+|++||||+.|||+|.
T Consensus        80 ~~~~~~~g~~hia~~v~d~d~~~~~l~~~G~~~~~~~~~~~~~~r~~~~~DPdG~~iEl~e~  141 (142)
T cd08353          80 PAPVNALGLRRVMFAVDDIDARVARLRKHGAELVGEVVQYENSYRLCYIRGPEGILIELAEQ  141 (142)
T ss_pred             CCCCCCCCceEEEEEeCCHHHHHHHHHHCCCceeCCceecCCCeEEEEEECCCCCEEEeeec
Confidence             12334567899999999999999999999998754    3467889999999999999984



This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The structures of this family demonstrate domain swapping, which is shared by glyoxalase I and antibiotic resistance proteins.

>PRK11478 putative lyase; Provisional Back     alignment and domain information
>PLN02367 lactoylglutathione lyase Back     alignment and domain information
>PLN03042 Lactoylglutathione lyase; Provisional Back     alignment and domain information
>cd08352 Glo_EDI_BRP_like_1 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd07241 Glo_EDI_BRP_like_3 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd08342 HPPD_N_like N-terminal domain of 4-hydroxyphenylpyruvate dioxygenase (HPPD) and hydroxymandelate Synthase (HmaS) Back     alignment and domain information
>TIGR03645 glyox_marine lactoylglutathione lyase family protein Back     alignment and domain information
>PRK04101 fosfomycin resistance protein FosB; Provisional Back     alignment and domain information
>cd08364 FosX FosX, a fosfomycin resistance protein, catalyzes the addition of a water molecule to the C1 position of the antibiotic with inversion of configuration at C1 Back     alignment and domain information
>TIGR00068 glyox_I lactoylglutathione lyase Back     alignment and domain information
>TIGR03081 metmalonyl_epim methylmalonyl-CoA epimerase Back     alignment and domain information
>cd08347 PcpA_C_like C-terminal domain of Sphingobium chlorophenolicum 2,6-dichloro-p-hydroquinone 1,2-dioxygenase (PcpA), and similar proteins Back     alignment and domain information
>cd07243 2_3_CTD_C C-terminal domain of catechol 2,3-dioxygenase Back     alignment and domain information
>cd07233 Glyoxalase_I Glyoxalase I catalyzes the isomerization of the hemithioacetal, formed by a 2-oxoaldehyde and glutathione, to S-D-lactoylglutathione Back     alignment and domain information
>cd07253 Glo_EDI_BRP_like_2 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd07245 Glo_EDI_BRP_like_9 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd08363 FosB FosB, a fosfomycin resistance protein, catalyzes the Mg(II) dependent addition of L-cysteine to the epoxide ring of fosfomycin Back     alignment and domain information
>cd07255 Glo_EDI_BRP_like_12 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>PLN02300 lactoylglutathione lyase Back     alignment and domain information
>cd09011 Glo_EDI_BRP_like_23 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd09014 BphC-JF8_C_like C-terminal, catalytic, domain of BphC_JF8, (2,3-dihydroxybiphenyl 1,2-dioxygenase) from Bacillus sp Back     alignment and domain information
>PRK10291 glyoxalase I; Provisional Back     alignment and domain information
>cd08355 Glo_EDI_BRP_like_14 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd09013 BphC-JF8_N_like N-terminal, non-catalytic, domain of BphC_JF8, (2,3-dihydroxybiphenyl 1,2-dioxygenase) from Bacillus sp Back     alignment and domain information
>cd08361 PpCmtC_N N-terminal domain of 2,3-dihydroxy-p-cumate-3,4-dioxygenase (PpCmtC) Back     alignment and domain information
>cd07267 THT_Oxygenase_N N-terminal domain of 2,4,5-trihydroxytoluene (THT) oxygenase Back     alignment and domain information
>cd07252 BphC1-RGP6_N_like N-terminal domain of 2,3-dihydroxybiphenyl 1,2-dioxygenase (BphC, EC 1 Back     alignment and domain information
>cd07247 SgaA_N_like N-terminal domain of Streptomyces griseus SgaA (suppression of growth disturbance caused by A-factor at a high concentration under high osmolality during early growth phase), and similar domains Back     alignment and domain information
>cd07257 THT_oxygenase_C The C-terminal domain of 2,4,5-Trihydroxytoluene (THT) oxygenase, which is an extradiol dioxygenease in the 2,4-dinitrotoluene (DNT) degradation pathway Back     alignment and domain information
>cd07265 2_3_CTD_N N-terminal domain of catechol 2,3-dioxygenase Back     alignment and domain information
>cd07263 Glo_EDI_BRP_like_16 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd08351 ChaP_like ChaP, an enzyme involved in the biosynthesis of the antitumor agent chartreusin (cha); and similar proteins Back     alignment and domain information
>cd07242 Glo_EDI_BRP_like_6 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd07244 FosA FosA, a Fosfomycin resistance protein, catalyzes the addition of glutathione to the antibiotic fosfomycin, making it inactive Back     alignment and domain information
>cd07240 ED_TypeI_classII_N N-terminal domain of type I, class II extradiol dioxygenases; non-catalytic domain Back     alignment and domain information
>cd08346 PcpA_N_like N-terminal domain of Sphingobium chlorophenolicum 2,6-dichloro-p-hydroquinone 1,2-dioxygenase (PcpA), and similar proteins Back     alignment and domain information
>cd08348 BphC2-C3-RGP6_C_like The single-domain 2,3-dihydroxybiphenyl 1,2-dioxygenases (BphC, EC 1 Back     alignment and domain information
>cd08345 Fosfomycin_RP Fosfomycin resistant protein; inhibits the biological function of fosfomycin Back     alignment and domain information
>cd08362 BphC5-RrK37_N_like N-terminal, non-catalytic, domain of BphC5 (2,3-dihydroxybiphenyl 1,2-dioxygenase) from Rhodococcus rhodochrous K37, and similar proteins Back     alignment and domain information
>cd07249 MMCE Methylmalonyl-CoA epimerase (MMCE) Back     alignment and domain information
>cd07264 Glo_EDI_BRP_like_15 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd08359 Glo_EDI_BRP_like_22 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd07246 Glo_EDI_BRP_like_8 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd08360 MhqB_like_C C-terminal domain of Burkholderia sp Back     alignment and domain information
>cd07237 BphC1-RGP6_C_like C-terminal domain of 2,3-dihydroxybiphenyl 1,2-dioxygenase (BphC, EC 1 Back     alignment and domain information
>PF00903 Glyoxalase: Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily This Prosite is specific to glyoxalases This Prosite is specific to Extradiol ring-cleavage dioxygenases This prints entry is specific to bleomycin resistance protein Back     alignment and domain information
>PRK06724 hypothetical protein; Provisional Back     alignment and domain information
>cd07256 HPCD_C_class_II C-terminal domain of 3,4-dihydroxyphenylacetate 2,3-dioxygenase (HPCD), which catalyses the second step in the degradation of 4-hydroxyphenylacetate to succinate and pyruvate; belongs to the type I class II family of extradiol dioxygenases Back     alignment and domain information
>cd07239 BphC5-RK37_C_like C-terminal, catalytic, domain of BphC5 (2,3-dihydroxybiphenyl 1,2-dioxygenase) from Bacterium Rhodococcus rhodochrous K37 and similar proteins Back     alignment and domain information
>cd07266 HPCD_N_class_II N-terminal domain of 3,4-dihydroxyphenylacetate 2,3-dioxygenase (HPCD); belongs to the type I class II family of extradiol dioxygenases Back     alignment and domain information
>cd08354 Glo_EDI_BRP_like_13 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd08350 BLMT_like BLMT, a bleomycin resistance protein encoded on the transposon Tn5, and similar proteins Back     alignment and domain information
>cd08343 ED_TypeI_classII_C C-terminal domain of type I, class II extradiol dioxygenases; catalytic domain Back     alignment and domain information
>cd08349 BLMA_like Bleomycin binding protein (BLMA) and similar proteins; BLMA confers bleomycin (Bm) resistance by directly binding to Bm Back     alignment and domain information
>cd08357 Glo_EDI_BRP_like_18 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd08358 Glo_EDI_BRP_like_21 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd07261 Glo_EDI_BRP_like_11 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd07254 Glo_EDI_BRP_like_20 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd07235 MRD Mitomycin C resistance protein (MRD) Back     alignment and domain information
>cd09012 Glo_EDI_BRP_like_24 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>PF12681 Glyoxalase_2: Glyoxalase-like domain; PDB: 3G12_B 1JIF_B 1JIE_B 1QTO_A 3OXH_A 2PJS_A 2RBB_A 3SK1_B 3SK2_B 3RRI_A Back     alignment and domain information
>cd08356 Glo_EDI_BRP_like_17 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd07238 Glo_EDI_BRP_like_5 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>TIGR03211 catechol_2_3 catechol 2,3 dioxygenase Back     alignment and domain information
>cd07258 PpCmtC_C C-terminal domain of 2,3-dihydroxy-p-cumate-3,4-dioxygenase (PpCmtC) Back     alignment and domain information
>cd06587 Glo_EDI_BRP_like This domain superfamily is found in a variety of structurally related metalloproteins, including the type I extradiol dioxygenases, glyoxalase I and a group of antibiotic resistance proteins Back     alignment and domain information
>cd08344 MhqB_like_N N-terminal domain of MhqB, a type I extradiol dioxygenase, and similar proteins Back     alignment and domain information
>cd07262 Glo_EDI_BRP_like_19 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd07251 Glo_EDI_BRP_like_10 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>TIGR03213 23dbph12diox 2,3-dihydroxybiphenyl 1,2-dioxygenase Back     alignment and domain information
>TIGR02295 HpaD 3,4-dihydroxyphenylacetate 2,3-dioxygenase Back     alignment and domain information
>TIGR03213 23dbph12diox 2,3-dihydroxybiphenyl 1,2-dioxygenase Back     alignment and domain information
>TIGR02295 HpaD 3,4-dihydroxyphenylacetate 2,3-dioxygenase Back     alignment and domain information
>TIGR03211 catechol_2_3 catechol 2,3 dioxygenase Back     alignment and domain information
>PF13669 Glyoxalase_4: Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily; PDB: 3RMU_B 3ISQ_A 1JC5_D 1JC4_D 3HDP_A 2QH0_A 3GM5_A 3OA4_A 3CT8_A Back     alignment and domain information
>COG2514 Predicted ring-cleavage extradiol dioxygenase [General function prediction only] Back     alignment and domain information
>KOG2944 consensus Glyoxalase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02300 lactoylglutathione lyase Back     alignment and domain information
>COG3324 Predicted enzyme related to lactoylglutathione lyase [General function prediction only] Back     alignment and domain information
>COG3607 Predicted lactoylglutathione lyase [General function prediction only] Back     alignment and domain information
>COG3565 Predicted dioxygenase of extradiol dioxygenase family [General function prediction only] Back     alignment and domain information
>cd07250 HPPD_C_like C-terminal domain of 4-hydroxyphenylpyruvate dioxygenase (HppD) and hydroxymandelate Synthase (HmaS) Back     alignment and domain information
>cd06588 PhnB_like Escherichia coli PhnB and similar proteins; the E Back     alignment and domain information
>COG2764 PhnB Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>TIGR01263 4HPPD 4-hydroxyphenylpyruvate dioxygenase Back     alignment and domain information
>TIGR01263 4HPPD 4-hydroxyphenylpyruvate dioxygenase Back     alignment and domain information
>COG0346 GloA Lactoylglutathione lyase and related lyases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK01037 trmD tRNA (guanine-N(1)-)-methyltransferase/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PLN02875 4-hydroxyphenylpyruvate dioxygenase Back     alignment and domain information
>KOG2943 consensus Predicted glyoxalase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF13468 Glyoxalase_3: Glyoxalase-like domain; PDB: 3P8A_B Back     alignment and domain information
>KOG2943 consensus Predicted glyoxalase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK10148 hypothetical protein; Provisional Back     alignment and domain information
>COG2514 Predicted ring-cleavage extradiol dioxygenase [General function prediction only] Back     alignment and domain information
>KOG0638 consensus 4-hydroxyphenylpyruvate dioxygenase [Amino acid transport and metabolism] Back     alignment and domain information
>PF14696 Glyoxalase_5: Hydroxyphenylpyruvate dioxygenase, HPPD, N-terminal ; PDB: 1CJX_A 2R5V_A Back     alignment and domain information
>PF14506 CppA_N: CppA N-terminal; PDB: 3E0R_D Back     alignment and domain information
>PLN02875 4-hydroxyphenylpyruvate dioxygenase Back     alignment and domain information
>COG3185 4-hydroxyphenylpyruvate dioxygenase and related hemolysins [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>COG3185 4-hydroxyphenylpyruvate dioxygenase and related hemolysins [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PF15067 FAM124: FAM124 family Back     alignment and domain information
>PF06983 3-dmu-9_3-mt: 3-demethylubiquinone-9 3-methyltransferase; PDB: 1U7I_A 1TSJ_A 1U69_D 3L20_B 3OMS_A Back     alignment and domain information
>KOG0638 consensus 4-hydroxyphenylpyruvate dioxygenase [Amino acid transport and metabolism] Back     alignment and domain information
>PF13669 Glyoxalase_4: Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily; PDB: 3RMU_B 3ISQ_A 1JC5_D 1JC4_D 3HDP_A 2QH0_A 3GM5_A 3OA4_A 3CT8_A Back     alignment and domain information
>PF14507 CppA_C: CppA C-terminal; PDB: 3E0R_D Back     alignment and domain information
>KOG2944 consensus Glyoxalase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd08353 Glo_EDI_BRP_like_7 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd08342 HPPD_N_like N-terminal domain of 4-hydroxyphenylpyruvate dioxygenase (HPPD) and hydroxymandelate Synthase (HmaS) Back     alignment and domain information
>PLN02367 lactoylglutathione lyase Back     alignment and domain information
>PF13468 Glyoxalase_3: Glyoxalase-like domain; PDB: 3P8A_B Back     alignment and domain information
>cd07249 MMCE Methylmalonyl-CoA epimerase (MMCE) Back     alignment and domain information
>cd08347 PcpA_C_like C-terminal domain of Sphingobium chlorophenolicum 2,6-dichloro-p-hydroquinone 1,2-dioxygenase (PcpA), and similar proteins Back     alignment and domain information
>cd08352 Glo_EDI_BRP_like_1 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>PRK11478 putative lyase; Provisional Back     alignment and domain information
>PF13670 PepSY_2: Peptidase propeptide and YPEB domain This Prosite motif covers only the active site Back     alignment and domain information
>TIGR03645 glyox_marine lactoylglutathione lyase family protein Back     alignment and domain information
>cd07242 Glo_EDI_BRP_like_6 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd08346 PcpA_N_like N-terminal domain of Sphingobium chlorophenolicum 2,6-dichloro-p-hydroquinone 1,2-dioxygenase (PcpA), and similar proteins Back     alignment and domain information
>cd07245 Glo_EDI_BRP_like_9 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>PLN03042 Lactoylglutathione lyase; Provisional Back     alignment and domain information
>cd07235 MRD Mitomycin C resistance protein (MRD) Back     alignment and domain information
>COG3865 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>cd06587 Glo_EDI_BRP_like This domain superfamily is found in a variety of structurally related metalloproteins, including the type I extradiol dioxygenases, glyoxalase I and a group of antibiotic resistance proteins Back     alignment and domain information
>PF06185 YecM: YecM protein; InterPro: IPR010393 This family consists of several bacterial YecM proteins of unknown function Back     alignment and domain information
>cd08348 BphC2-C3-RGP6_C_like The single-domain 2,3-dihydroxybiphenyl 1,2-dioxygenases (BphC, EC 1 Back     alignment and domain information
>cd07241 Glo_EDI_BRP_like_3 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>PRK10291 glyoxalase I; Provisional Back     alignment and domain information
>cd07255 Glo_EDI_BRP_like_12 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>TIGR03081 metmalonyl_epim methylmalonyl-CoA epimerase Back     alignment and domain information
>cd07252 BphC1-RGP6_N_like N-terminal domain of 2,3-dihydroxybiphenyl 1,2-dioxygenase (BphC, EC 1 Back     alignment and domain information
>cd07263 Glo_EDI_BRP_like_16 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd07250 HPPD_C_like C-terminal domain of 4-hydroxyphenylpyruvate dioxygenase (HppD) and hydroxymandelate Synthase (HmaS) Back     alignment and domain information
>TIGR00068 glyox_I lactoylglutathione lyase Back     alignment and domain information
>cd08344 MhqB_like_N N-terminal domain of MhqB, a type I extradiol dioxygenase, and similar proteins Back     alignment and domain information
>PRK11700 hypothetical protein; Provisional Back     alignment and domain information
>PF12681 Glyoxalase_2: Glyoxalase-like domain; PDB: 3G12_B 1JIF_B 1JIE_B 1QTO_A 3OXH_A 2PJS_A 2RBB_A 3SK1_B 3SK2_B 3RRI_A Back     alignment and domain information
>cd07268 Glo_EDI_BRP_like_4 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd07262 Glo_EDI_BRP_like_19 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>PF00903 Glyoxalase: Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily This Prosite is specific to glyoxalases This Prosite is specific to Extradiol ring-cleavage dioxygenases This prints entry is specific to bleomycin resistance protein Back     alignment and domain information
>cd07233 Glyoxalase_I Glyoxalase I catalyzes the isomerization of the hemithioacetal, formed by a 2-oxoaldehyde and glutathione, to S-D-lactoylglutathione Back     alignment and domain information
>cd07253 Glo_EDI_BRP_like_2 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd08359 Glo_EDI_BRP_like_22 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd07240 ED_TypeI_classII_N N-terminal domain of type I, class II extradiol dioxygenases; non-catalytic domain Back     alignment and domain information
>cd08360 MhqB_like_C C-terminal domain of Burkholderia sp Back     alignment and domain information
>cd04883 ACT_AcuB C-terminal ACT domain of the Bacillus subtilis acetoin utilization protein, AcuB Back     alignment and domain information
>cd08363 FosB FosB, a fosfomycin resistance protein, catalyzes the Mg(II) dependent addition of L-cysteine to the epoxide ring of fosfomycin Back     alignment and domain information
>cd09012 Glo_EDI_BRP_like_24 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd07257 THT_oxygenase_C The C-terminal domain of 2,4,5-Trihydroxytoluene (THT) oxygenase, which is an extradiol dioxygenease in the 2,4-dinitrotoluene (DNT) degradation pathway Back     alignment and domain information
>cd04882 ACT_Bt0572_2 C-terminal ACT domain of a novel protein composed of just two ACT domains Back     alignment and domain information
>cd07238 Glo_EDI_BRP_like_5 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd07265 2_3_CTD_N N-terminal domain of catechol 2,3-dioxygenase Back     alignment and domain information
>cd08361 PpCmtC_N N-terminal domain of 2,3-dihydroxy-p-cumate-3,4-dioxygenase (PpCmtC) Back     alignment and domain information
>PF07063 DUF1338: Domain of unknown function (DUF1338); InterPro: IPR009770 This domain is found in a variety of bacterial and fungal hypothetical proteins of unknown function Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query138
3rmu_A134 Crystal Structure Of Human Methylmalonyl-Coa Epimer 2e-06
>pdb|3RMU|A Chain A, Crystal Structure Of Human Methylmalonyl-Coa Epimerase, Mcee Length = 134 Back     alignment and structure

Iteration: 1

Score = 48.1 bits (113), Expect = 2e-06, Method: Compositional matrix adjust. Identities = 34/121 (28%), Positives = 55/121 (45%), Gaps = 14/121 (11%) Query: 18 VHHVGILCENLERSLEFYQNILGLEINEARPHDKLPYRGAWLW------VGAEMIHLMEL 71 ++HV I +LE++ FY+NILG +++EA P LP G + E++H + L Sbjct: 6 LNHVAIAVPDLEKAAAFYKNILGAQVSEAVP---LPEHGVSVVFVNLGNTKMELLHPLGL 62 Query: 72 PNPDPLSGRPEHGGRDRHTCIAIRDVSKLKMILDKAGI-----SYTLSKSGRPAIFTRDP 126 +P + G H CI + +++ M L K I + G+P IF Sbjct: 63 DSPIAGFLQKNKAGGMHHICIEVDNINAAVMDLKKKKIRSLSEEVKIGAHGKPVIFLHPK 122 Query: 127 D 127 D Sbjct: 123 D 123

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query138
2p25_A126 Glyoxalase family protein; structural genomics, MC 2e-30
3l7t_A134 SMU.1112C, putative uncharacterized protein; metal 9e-27
2qqz_A126 Glyoxalase family protein, putative; alpha-beta st 2e-26
1npb_A141 Fosfomycin-resistance protein; manganese binding, 2e-23
1nki_A135 Probable fosfomycin resistance protein; potassium 9e-22
3ghj_A141 Putative integron gene cassette protein; integron 3e-21
3kol_A156 Oxidoreductase, glyoxalase/bleomycin resistance pr 6e-21
3uh9_A145 Metallothiol transferase FOSB 2; structural genomi 3e-19
2rk0_A136 Glyoxalase/bleomycin resistance protein/dioxygena; 1e-17
3r4q_A160 Lactoylglutathione lyase; structural genomics, PSI 2e-17
3rmu_A134 Methylmalonyl-COA epimerase, mitochondrial; struct 3e-17
1r9c_A139 Glutathione transferase; fosfomycin resistance pro 8e-17
3hdp_A133 Glyoxalase-I; glutathione,lyase, methylglyoxal,110 1e-16
3huh_A152 Virulence protein STM3117; structural genomics, ny 6e-16
2p7o_A133 Glyoxalase family protein; fosfomycin resistance p 1e-15
3e5d_A127 Putative glyoxalase I; structural genomics, joint 4e-15
3ey7_A133 Biphenyl-2,3-DIOL 1,2-dioxygenase III-related prot 4e-15
3oa4_A161 Glyoxalase, BH1468 protein; structural genomics, p 7e-14
1ss4_A153 Glyoxalase family protein; structural genomics, PS 4e-13
3ct8_A146 Protein BH2160, putative glyoxalase; NP_243026.1, 9e-13
3zw5_A147 Glyoxalase domain-containing protein 5; lyase; 1.6 1e-12
3oaj_A 335 Putative ring-cleaving dioxygenase MHQO; structura 2e-11
3oaj_A335 Putative ring-cleaving dioxygenase MHQO; structura 5e-05
2rk9_A145 Glyoxalase/bleomycin resistance protein/dioxygena; 3e-11
1zsw_A 338 Metallo protein, glyoxalase family protein; hypoth 6e-11
1zsw_A338 Metallo protein, glyoxalase family protein; hypoth 8e-05
2qnt_A141 AGR_C_3434P, uncharacterized protein ATU1872; glyo 1e-10
2rbb_A141 Glyoxalase/bleomycin resistance protein/dioxygena; 3e-10
1xqa_A113 Glyoxalase/bleomycin resistance protein; dioxygena 1e-09
3rri_A135 Glyoxalase/bleomycin resistance protein/dioxygena; 1e-09
3pkv_A 252 Toxoflavin lyase (TFLA); metalloenzyme, vicinal ox 1e-09
4g6x_A155 Glyoxalase/bleomycin resistance protein/dioxygena; 1e-09
3g12_A128 Putative lactoylglutathione lyase; glyoxalase, ble 4e-09
3r6a_A144 Uncharacterized protein; PSI biology, structural g 1e-08
2c21_A144 Trypanothione-dependent glyoxalase I; lyase, gluta 5e-08
3gm5_A159 Lactoylglutathione lyase and related lyases; sheet 7e-08
2i7r_A118 Conserved domain protein; structural genomics cons 8e-08
2za0_A184 Glyoxalase I; lyase, lactoylglutathione lyase, met 1e-07
3fcd_A134 Lyase, ORF125EGC139; lactoylglutathione lyase, YEC 1e-07
3bqx_A150 Glyoxalase-related enzyme; VOC superfamily, PSI-2, 2e-07
2kjz_A144 ATC0852; protein of unknown function, dimer, struc 3e-07
3bt3_A148 Glyoxalase-related enzyme, ARAC type; VOC superfam 3e-07
1mpy_A 307 Catechol 2,3-dioxygenase; extradiol dioxygenase, n 3e-07
1mpy_A307 Catechol 2,3-dioxygenase; extradiol dioxygenase, n 4e-05
1f9z_A135 Glyoxalase I; beta-alpha-beta-BETA-beta motif, pro 6e-07
3m2o_A164 Glyoxalase/bleomycin resistance protein; unknown f 8e-07
3rhe_A148 NAD-dependent benzaldehyde dehydrogenase; structur 1e-06
3lm4_A 339 Catechol 2,3-dioxygenase; NYSGXRC, PSI-II, protein 3e-06
3lm4_A339 Catechol 2,3-dioxygenase; NYSGXRC, PSI-II, protein 1e-04
1jc4_A148 Methylmalonyl-COA epimerase; vicinal oxygen chelat 5e-06
2pjs_A119 AGR_C_3564P, uncharacterized protein ATU1953; glyo 1e-05
1f1u_A 323 Homoprotocatechuate 2,3-dioxygenase; extradiol, ma 1e-05
3eck_A 365 Protein (homoprotocatechuate 2,3-dioxygenase); oxi 2e-05
3hpy_A 309 Catechol 2,3-dioxygenase; repeated motifs, aromati 2e-05
2a4x_A138 Mitomycin-binding protein; ALFA/beta protein, mito 2e-05
1xrk_A124 Bleomycin resistance protein; arm exchange, ligand 3e-05
1twu_A139 Hypothetical protein YYCE; structural genomics, pr 2e-04
3b59_A 310 Glyoxalase/bleomycin resistance protein/dioxygena; 2e-04
3sk2_A132 EHPR; antibiotic resistance, griseoluteate-binding 3e-04
1ecs_A126 Bleomycin resistance protein; arm-exchange, antibi 3e-04
2wl9_A 305 Catechol 2,3-dioxygenase; aromatic hydrocarbons ca 4e-04
3itw_A137 Protein TIOX; bleomycin resistance fold, bisinterc 5e-04
1qto_A122 Bleomycin-binding protein; arm-exchange, antibioti 5e-04
2ehz_A 302 1,2-dihydroxynaphthalene dioxygenase; extradiol di 7e-04
>2p25_A Glyoxalase family protein; structural genomics, MCSG, PSI-2, protein struct initiative, midwest center for structural genomics, oxidore; 1.70A {Enterococcus faecalis} Length = 126 Back     alignment and structure
 Score =  105 bits (264), Expect = 2e-30
 Identities = 27/123 (21%), Positives = 47/123 (38%), Gaps = 5/123 (4%)

Query: 17  SVHHVGILCENLERSLEFYQNILGLEINEARPHDKLPYRGAWLWVGAEMIHLMELPNPDP 76
            +HHV I   N + +  FY   LG E+       +       L +G++ + +        
Sbjct: 5   EIHHVAINASNYQATKNFYVEKLGFEVLRENHRPEKNDIKLDLKLGSQELEIFISDQFPA 64

Query: 77  LSGRPEHGGRDRHTCIAIRDVSKLKMILDKAGISYTLSK----SGRPAIFTRDPDANALE 132
               PE  G  RH    +  + ++   L++ GI     +    +G+   F  DPD   LE
Sbjct: 65  RPSYPEALGL-RHLAFKVEHIEEVIAFLNEQGIETEPLRVDDFTGKKMTFFFDPDGLPLE 123

Query: 133 FTQ 135
             +
Sbjct: 124 LHE 126


>3l7t_A SMU.1112C, putative uncharacterized protein; metal binding protein; 1.80A {Streptococcus mutans} Length = 134 Back     alignment and structure
>2qqz_A Glyoxalase family protein, putative; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; HET: MSE; 1.92A {Bacillus anthracis str} Length = 126 Back     alignment and structure
>1npb_A Fosfomycin-resistance protein; manganese binding, potassium binding loop, transferase; 2.50A {Serratia marcescens} SCOP: d.32.1.2 Length = 141 Back     alignment and structure
>1nki_A Probable fosfomycin resistance protein; potassium binding loop, manganese binding, transferase; 0.95A {Pseudomonas aeruginosa} SCOP: d.32.1.2 PDB: 1lqo_A 1lqk_A 1lqp_A 1nnr_A Length = 135 Back     alignment and structure
>3ghj_A Putative integron gene cassette protein; integron cassette protein, mobIle metagenome, structural genomics, PSI-2; 1.47A {Uncultured bacterium} Length = 141 Back     alignment and structure
>3kol_A Oxidoreductase, glyoxalase/bleomycin resistance protein/dioxygenase; metal ION binding, NYSGXRC, PSI2, structural genomics; 1.90A {Nostoc punctiforme pcc 73102} Length = 156 Back     alignment and structure
>2rk0_A Glyoxalase/bleomycin resistance protein/dioxygena; 11002Z, glyoxylase, dioxygenas PSI-II; 2.04A {Frankia SP} Length = 136 Back     alignment and structure
>3r4q_A Lactoylglutathione lyase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.51A {Agrobacterium tumefaciens} Length = 160 Back     alignment and structure
>3rmu_A Methylmalonyl-COA epimerase, mitochondrial; structural genomics consortium, SGC, vitamin B12, mitochondr isomerase; HET: PG4; 1.80A {Homo sapiens} Length = 134 Back     alignment and structure
>1r9c_A Glutathione transferase; fosfomycin resistance protein, Mn binding, antibiotic resist transferase; 1.83A {Mesorhizobium loti} SCOP: d.32.1.2 Length = 139 Back     alignment and structure
>3hdp_A Glyoxalase-I; glutathione,lyase, methylglyoxal,11003P,PSI2, structural GENOMIC,NYSGXRC., structural genomics; 2.06A {Clostridium acetobutylicum} PDB: 2qh0_A Length = 133 Back     alignment and structure
>3huh_A Virulence protein STM3117; structural genomics, nysgrc, target 13955A1BCT15P1, dioxygenase, PSI-2, protein structure initiative; 1.50A {Salmonella enterica subsp} PDB: 3hnq_A Length = 152 Back     alignment and structure
>2p7o_A Glyoxalase family protein; fosfomycin resistance protein, Mn binding, antibiotic resist metal binding protein, hydrolase; 1.44A {Listeria monocytogenes} PDB: 2p7k_A 2p7l_A 2p7m_A 2p7p_A 2p7q_A Length = 133 Back     alignment and structure
>3e5d_A Putative glyoxalase I; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, lyase; 2.70A {Listeria monocytogenes str} Length = 127 Back     alignment and structure
>3ey7_A Biphenyl-2,3-DIOL 1,2-dioxygenase III-related protein; integron cassette protein mobIle metagenome structural genomics, oxidoreductase, PSI-2; HET: MSE; 1.60A {Vibrio cholerae} PDB: 3ey8_A* Length = 133 Back     alignment and structure
>3oa4_A Glyoxalase, BH1468 protein; structural genomics, protein structure initiative, glyoxalas PSI-biology, lyase; 1.94A {Bacillus halodurans} Length = 161 Back     alignment and structure
>1ss4_A Glyoxalase family protein; structural genomics, PSI, prote structure initiative, midwest center for structural genomic unknown function; HET: CIT GSH; 1.84A {Bacillus cereus} SCOP: d.32.1.6 Length = 153 Back     alignment and structure
>3ct8_A Protein BH2160, putative glyoxalase; NP_243026.1, glyoxalase/bleomycin resis protein/dioxygenase superfamily, structural genomics; HET: UNL; 2.10A {Bacillus halodurans c-125} Length = 146 Back     alignment and structure
>3zw5_A Glyoxalase domain-containing protein 5; lyase; 1.60A {Homo sapiens} Length = 147 Back     alignment and structure
>3oaj_A Putative ring-cleaving dioxygenase MHQO; structural genomics, protein structure initiative, PSI-biolo unknown function; 1.40A {Bacillus subtilis subsp} Length = 335 Back     alignment and structure
>3oaj_A Putative ring-cleaving dioxygenase MHQO; structural genomics, protein structure initiative, PSI-biolo unknown function; 1.40A {Bacillus subtilis subsp} Length = 335 Back     alignment and structure
>2rk9_A Glyoxalase/bleomycin resistance protein/dioxygena; NYSGXRC, structural genomics, protein structur initiative II; 1.60A {Vibrio splendidus} Length = 145 Back     alignment and structure
>1zsw_A Metallo protein, glyoxalase family protein; hypothetical protein from glyoxalase family, structural GENO PSI, protein structure initiative; 1.65A {Bacillus cereus} SCOP: d.32.1.10 d.32.1.10 Length = 338 Back     alignment and structure
>1zsw_A Metallo protein, glyoxalase family protein; hypothetical protein from glyoxalase family, structural GENO PSI, protein structure initiative; 1.65A {Bacillus cereus} SCOP: d.32.1.10 d.32.1.10 Length = 338 Back     alignment and structure
>2qnt_A AGR_C_3434P, uncharacterized protein ATU1872; glyoxalase/bleomycin resistance protein/dioxygenase family R protein, PSI-2, MCSG; HET: MSE EPE; 1.40A {Agrobacterium tumefaciens str} Length = 141 Back     alignment and structure
>2rbb_A Glyoxalase/bleomycin resistance protein/dioxygena; structural genomics, PSI-2, PROT structure initiative; 1.82A {Burkholderia phytofirmans} Length = 141 Back     alignment and structure
>1xqa_A Glyoxalase/bleomycin resistance protein; dioxygenase, structural GEN midwest center for structural genomics, MCSG; HET: P6G; 1.80A {Bacillus cereus atcc 14579} SCOP: d.32.1.2 Length = 113 Back     alignment and structure
>3rri_A Glyoxalase/bleomycin resistance protein/dioxygena; structural genomics, PSI-biology, midwest center for structu genomics; 1.50A {Alicyclobacillus acidocaldarius subsp} Length = 135 Back     alignment and structure
>3pkv_A Toxoflavin lyase (TFLA); metalloenzyme, vicinal oxygen chelate superfamily; 1.34A {Paenibacillus polymyxa} PDB: 3pkw_A 3pkx_A* 3oul_A 3oum_A* Length = 252 Back     alignment and structure
>4g6x_A Glyoxalase/bleomycin resistance protein/dioxygena; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 1.73A {Catenulispora acidiphila} Length = 155 Back     alignment and structure
>3g12_A Putative lactoylglutathione lyase; glyoxalase, bleomycin resistance, PSI-2, NYSGXRC, structural genomics; 2.58A {Bdellovibrio bacteriovorus HD100} Length = 128 Back     alignment and structure
>3r6a_A Uncharacterized protein; PSI biology, structural genomics, NEW YORK structural genomi research consortium, putative glyoxalase I; 1.76A {Methanosarcina mazei} Length = 144 Back     alignment and structure
>2c21_A Trypanothione-dependent glyoxalase I; lyase, glutathionylspermidine, methylglyoxal, detoxification; 2.0A {Leishmania major} SCOP: d.32.1.1 Length = 144 Back     alignment and structure
>3gm5_A Lactoylglutathione lyase and related lyases; sheet-helix-sheet-sheet-sheet motif, isomerase; HET: CIT; 2.00A {Thermoanaerobacter tengcongensis} Length = 159 Back     alignment and structure
>2i7r_A Conserved domain protein; structural genomics conserved domain, PSI-2, protein structure initiative; 2.20A {Streptococcus pneumoniae} SCOP: d.32.1.2 Length = 118 Back     alignment and structure
>2za0_A Glyoxalase I; lyase, lactoylglutathione lyase, methyl- gerfelin; HET: MGI; 1.70A {Mus musculus} PDB: 1qip_A* 1fro_A* 1qin_A* 1bh5_A* Length = 184 Back     alignment and structure
>3fcd_A Lyase, ORF125EGC139; lactoylglutathione lyase, YECM, PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.92A {Uncultured bacterium} Length = 134 Back     alignment and structure
>3bqx_A Glyoxalase-related enzyme; VOC superfamily, PSI-2, STRU genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; 1.40A {Fulvimarina pelagi} Length = 150 Back     alignment and structure
>2kjz_A ATC0852; protein of unknown function, dimer, structural genomics, PSI protein structure initiative; NMR {Agrobacterium tumefaciens} Length = 144 Back     alignment and structure
>3bt3_A Glyoxalase-related enzyme, ARAC type; VOC superfamily, PSI-2, NYSGXRC, structural genomics, prote structure initiative; 2.50A {Clostridium phytofermentans} Length = 148 Back     alignment and structure
>1mpy_A Catechol 2,3-dioxygenase; extradiol dioxygenase, non heme iron dioxygenase, metapyrocatechase, oxidoreductase; 2.80A {Pseudomonas putida} SCOP: d.32.1.3 d.32.1.3 Length = 307 Back     alignment and structure
>1mpy_A Catechol 2,3-dioxygenase; extradiol dioxygenase, non heme iron dioxygenase, metapyrocatechase, oxidoreductase; 2.80A {Pseudomonas putida} SCOP: d.32.1.3 d.32.1.3 Length = 307 Back     alignment and structure
>1f9z_A Glyoxalase I; beta-alpha-beta-BETA-beta motif, protein-NI(II) complex, homodimer, lyase; 1.50A {Escherichia coli} SCOP: d.32.1.1 PDB: 1fa5_A 1fa6_A 1fa7_A 1fa8_A Length = 135 Back     alignment and structure
>3rhe_A NAD-dependent benzaldehyde dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, SGX; 2.05A {Legionella pneumophila} Length = 148 Back     alignment and structure
>3lm4_A Catechol 2,3-dioxygenase; NYSGXRC, PSI-II, protein structure initiative, 2hydroxyl 6 OXO 6 phenyl hexa 2-4 dienoic acid, peroxide; HET: HPX; 1.80A {Rhodococcus jostii} Length = 339 Back     alignment and structure
>3lm4_A Catechol 2,3-dioxygenase; NYSGXRC, PSI-II, protein structure initiative, 2hydroxyl 6 OXO 6 phenyl hexa 2-4 dienoic acid, peroxide; HET: HPX; 1.80A {Rhodococcus jostii} Length = 339 Back     alignment and structure
>1jc4_A Methylmalonyl-COA epimerase; vicinal oxygen chelate superfamily, isomerase; 2.00A {Propionibacterium freudenreichiisubsp} SCOP: d.32.1.4 PDB: 1jc5_A Length = 148 Back     alignment and structure
>2pjs_A AGR_C_3564P, uncharacterized protein ATU1953; glyoxalase/bleomycin resistance protein/dioxygenase superfamily, structural genomics; 1.85A {Agrobacterium tumefaciens str} SCOP: d.32.1.2 Length = 119 Back     alignment and structure
>1f1u_A Homoprotocatechuate 2,3-dioxygenase; extradiol, manganese, biodegradation, aromatic, oxidoreductase; 1.50A {Arthrobacter globiformis} SCOP: d.32.1.3 d.32.1.3 PDB: 1f1r_A 1f1v_A* 1f1x_A Length = 323 Back     alignment and structure
>3eck_A Protein (homoprotocatechuate 2,3-dioxygenase); oxidoreductase, extradiol, FEII, crystal packing; HET: XXG; 1.60A {Brevibacterium fuscum} SCOP: d.32.1.3 d.32.1.3 PDB: 3ecj_A* 3ojn_A* 1q0o_A 1q0c_A 2iga_A* 2ig9_A 3ojj_A* 3bza_A* 3ojk_A* 3ojt_A* Length = 365 Back     alignment and structure
>3hpy_A Catechol 2,3-dioxygenase; repeated motifs, aromatic hydrocarbons catabolism, iron, oxidoreductase; 1.94A {Pseudomonas SP} PDB: 3hpv_A 3hq0_A* Length = 309 Back     alignment and structure
>2a4x_A Mitomycin-binding protein; ALFA/beta protein, mitomycin C-binding protein, bleomycin A2, antimicrobial protein; HET: BLM; 1.40A {Streptomyces caespitosus} SCOP: d.32.1.2 PDB: 2a4w_A* 1kmz_A 1kll_A* Length = 138 Back     alignment and structure
>1xrk_A Bleomycin resistance protein; arm exchange, ligand binding protein, thermostable mutant, antibiotic inhibitor; HET: BLM; 1.50A {Streptoalloteichus hindustanus} SCOP: d.32.1.2 PDB: 2zhp_A* 1byl_A Length = 124 Back     alignment and structure
>1twu_A Hypothetical protein YYCE; structural genomics, protein structure initiative, MCSG, DUP of the alpha-beta sandwichs. bacillus subtilis, PSI; 2.00A {Bacillus subtilis} SCOP: d.32.1.8 Length = 139 Back     alignment and structure
>3b59_A Glyoxalase/bleomycin resistance protein/dioxygena; 11004Z, NYSGXRC, PSI-2, structural genomics, Pro structure initiative; 2.53A {Novosphingobium aromaticivorans} Length = 310 Back     alignment and structure
>3sk2_A EHPR; antibiotic resistance, griseoluteate-binding protein; HET: GRI; 1.01A {Pantoea agglomerans} PDB: 3sk1_A* Length = 132 Back     alignment and structure
>1ecs_A Bleomycin resistance protein; arm-exchange, antibiotic inhibitor; HET: PG4; 1.70A {Klebsiella pneumoniae} SCOP: d.32.1.2 PDB: 1ewj_A* 1niq_B* 1mh6_A Length = 126 Back     alignment and structure
>2wl9_A Catechol 2,3-dioxygenase; aromatic hydrocarbons catabolism, iron, oxidoreductase; 1.90A {Rhodococcus SP} PDB: 2wl3_A Length = 305 Back     alignment and structure
>3itw_A Protein TIOX; bleomycin resistance fold, bisintercalator, solvent-exposed residue, thiocoraline, protein binding, peptide binding Pro; 2.15A {Micromonospora SP} Length = 137 Back     alignment and structure
>1qto_A Bleomycin-binding protein; arm-exchange, antibiotic inhibitor; 1.50A {Streptomyces verticillus} SCOP: d.32.1.2 PDB: 1jie_A* 1jif_A Length = 122 Back     alignment and structure
>2ehz_A 1,2-dihydroxynaphthalene dioxygenase; extradiol dioxygenase, protein substrate complex, oxidoreduc; 1.35A {Pseudomonas SP} PDB: 2ei0_A* 2ei1_A* 2ei3_A* 2ei2_A Length = 302 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query138
3l7t_A134 SMU.1112C, putative uncharacterized protein; metal 99.95
2p25_A126 Glyoxalase family protein; structural genomics, MC 99.94
3kol_A156 Oxidoreductase, glyoxalase/bleomycin resistance pr 99.93
3ey7_A133 Biphenyl-2,3-DIOL 1,2-dioxygenase III-related prot 99.93
3hdp_A133 Glyoxalase-I; glutathione,lyase, methylglyoxal,110 99.93
2qqz_A126 Glyoxalase family protein, putative; alpha-beta st 99.93
3rmu_A134 Methylmalonyl-COA epimerase, mitochondrial; struct 99.93
2rk0_A136 Glyoxalase/bleomycin resistance protein/dioxygena; 99.93
2c21_A144 Trypanothione-dependent glyoxalase I; lyase, gluta 99.93
3huh_A152 Virulence protein STM3117; structural genomics, ny 99.93
3e5d_A127 Putative glyoxalase I; structural genomics, joint 99.93
3gm5_A159 Lactoylglutathione lyase and related lyases; sheet 99.92
3uh9_A145 Metallothiol transferase FOSB 2; structural genomi 99.92
3oa4_A161 Glyoxalase, BH1468 protein; structural genomics, p 99.92
4g6x_A155 Glyoxalase/bleomycin resistance protein/dioxygena; 99.92
1f9z_A135 Glyoxalase I; beta-alpha-beta-BETA-beta motif, pro 99.92
1nki_A135 Probable fosfomycin resistance protein; potassium 99.92
3zw5_A147 Glyoxalase domain-containing protein 5; lyase; 1.6 99.92
1ss4_A153 Glyoxalase family protein; structural genomics, PS 99.91
1npb_A141 Fosfomycin-resistance protein; manganese binding, 99.91
2p7o_A133 Glyoxalase family protein; fosfomycin resistance p 99.91
3vw9_A187 Lactoylglutathione lyase; glyoxalase, lyase-lyase 99.91
1r9c_A139 Glutathione transferase; fosfomycin resistance pro 99.91
3ghj_A141 Putative integron gene cassette protein; integron 99.91
3bqx_A150 Glyoxalase-related enzyme; VOC superfamily, PSI-2, 99.91
3r4q_A160 Lactoylglutathione lyase; structural genomics, PSI 99.91
4hc5_A133 Glyoxalase/bleomycin resistance protein/dioxygena; 99.9
3sk2_A132 EHPR; antibiotic resistance, griseoluteate-binding 99.9
3rhe_A148 NAD-dependent benzaldehyde dehydrogenase; structur 99.9
3g12_A128 Putative lactoylglutathione lyase; glyoxalase, ble 99.9
1jc4_A148 Methylmalonyl-COA epimerase; vicinal oxygen chelat 99.9
2i7r_A118 Conserved domain protein; structural genomics cons 99.9
1xrk_A124 Bleomycin resistance protein; arm exchange, ligand 99.9
2a4x_A138 Mitomycin-binding protein; ALFA/beta protein, mito 99.9
2za0_A184 Glyoxalase I; lyase, lactoylglutathione lyase, met 99.89
3rri_A135 Glyoxalase/bleomycin resistance protein/dioxygena; 99.89
2pjs_A119 AGR_C_3564P, uncharacterized protein ATU1953; glyo 99.89
3itw_A137 Protein TIOX; bleomycin resistance fold, bisinterc 99.89
3m2o_A164 Glyoxalase/bleomycin resistance protein; unknown f 99.89
2kjz_A144 ATC0852; protein of unknown function, dimer, struc 99.89
3ct8_A146 Protein BH2160, putative glyoxalase; NP_243026.1, 99.88
3r6a_A144 Uncharacterized protein; PSI biology, structural g 99.88
3fcd_A134 Lyase, ORF125EGC139; lactoylglutathione lyase, YEC 99.88
2r6u_A148 Uncharacterized protein; structural genomics, PSI- 99.88
2rbb_A141 Glyoxalase/bleomycin resistance protein/dioxygena; 99.88
4gym_A149 Glyoxalase/bleomycin resistance protein/dioxygena; 99.88
1ecs_A126 Bleomycin resistance protein; arm-exchange, antibi 99.88
1qto_A122 Bleomycin-binding protein; arm-exchange, antibioti 99.88
1xqa_A113 Glyoxalase/bleomycin resistance protein; dioxygena 99.87
3oaj_A335 Putative ring-cleaving dioxygenase MHQO; structura 99.85
3oaj_A 335 Putative ring-cleaving dioxygenase MHQO; structura 99.85
2qnt_A141 AGR_C_3434P, uncharacterized protein ATU1872; glyo 99.85
3pkv_A 252 Toxoflavin lyase (TFLA); metalloenzyme, vicinal ox 99.85
1twu_A139 Hypothetical protein YYCE; structural genomics, pr 99.84
2rk9_A145 Glyoxalase/bleomycin resistance protein/dioxygena; 99.84
1zsw_A 338 Metallo protein, glyoxalase family protein; hypoth 99.83
3bt3_A148 Glyoxalase-related enzyme, ARAC type; VOC superfam 99.83
3lm4_A339 Catechol 2,3-dioxygenase; NYSGXRC, PSI-II, protein 99.83
1zsw_A338 Metallo protein, glyoxalase family protein; hypoth 99.82
1lgt_A 297 Biphenyl-2,3-DIOL 1,2-dioxygenase; extradiol dioxy 99.81
4ghg_A 365 Homoprotocatechuate 2,3-dioxygenase; oxygen activa 99.81
3hpy_A309 Catechol 2,3-dioxygenase; repeated motifs, aromati 99.81
2ehz_A 302 1,2-dihydroxynaphthalene dioxygenase; extradiol di 99.81
2zyq_A 300 Probable biphenyl-2,3-DIOL 1,2-dioxygenase BPHC; e 99.81
1kw3_B 292 2,3-dihydroxybiphenyl dioxygenase; four TIME repet 99.81
3hpy_A 309 Catechol 2,3-dioxygenase; repeated motifs, aromati 99.81
1f1u_A323 Homoprotocatechuate 2,3-dioxygenase; extradiol, ma 99.81
2wl9_A 305 Catechol 2,3-dioxygenase; aromatic hydrocarbons ca 99.8
1mpy_A307 Catechol 2,3-dioxygenase; extradiol dioxygenase, n 99.8
3zi1_A 330 Glyoxalase domain-containing protein 4; isomerase; 99.79
3oxh_A282 RV0577 protein; kinase regulation, antibiotic resi 99.79
3lm4_A 339 Catechol 2,3-dioxygenase; NYSGXRC, PSI-II, protein 99.79
1f1u_A 323 Homoprotocatechuate 2,3-dioxygenase; extradiol, ma 99.79
2zyq_A300 Probable biphenyl-2,3-DIOL 1,2-dioxygenase BPHC; e 99.79
1mpy_A 307 Catechol 2,3-dioxygenase; extradiol dioxygenase, n 99.78
3b59_A 310 Glyoxalase/bleomycin resistance protein/dioxygena; 99.78
3b59_A310 Glyoxalase/bleomycin resistance protein/dioxygena; 99.78
3zi1_A330 Glyoxalase domain-containing protein 4; isomerase; 99.77
2wl9_A305 Catechol 2,3-dioxygenase; aromatic hydrocarbons ca 99.76
3oxh_A 282 RV0577 protein; kinase regulation, antibiotic resi 99.76
2r5v_A357 PCZA361.1; dioxygenase, non-heme iron, vancomycin, 99.75
2ehz_A302 1,2-dihydroxynaphthalene dioxygenase; extradiol di 99.75
1lgt_A297 Biphenyl-2,3-DIOL 1,2-dioxygenase; extradiol dioxy 99.75
1kw3_B292 2,3-dihydroxybiphenyl dioxygenase; four TIME repet 99.74
1xy7_A166 Unknown protein; structural genomics, protein stru 99.73
2zw5_A301 Bleomycin acetyltransferase; dimer, two domains; H 99.71
1u6l_A149 Hypothetical protein; structural genomics, PSI, pr 99.7
4ghg_A365 Homoprotocatechuate 2,3-dioxygenase; oxygen activa 99.69
1t47_A 381 4-hydroxyphenylpyruvate dioxygenase; triketone inh 99.69
1sqd_A 424 4-hydroxyphenylpyruvate dioxygenase; oxidoreductas 99.68
2r5v_A 357 PCZA361.1; dioxygenase, non-heme iron, vancomycin, 99.67
1u7i_A136 Hypothetical protein; structural genomics, PA1358, 99.67
1tsj_A139 Conserved hypothetical protein; structural genomic 99.63
1t47_A381 4-hydroxyphenylpyruvate dioxygenase; triketone inh 99.61
1sp8_A 418 4-hydroxyphenylpyruvate dioxygenase; oxidoreductas 99.59
3isq_A 393 4-hydroxyphenylpyruvate dioxygenase; tyrosine meta 99.58
3l20_A172 Putative uncharacterized protein; hypothetical pro 99.58
1cjx_A357 4-hydroxyphenylpyruvate dioxygenase; oxidoreductas 99.56
1cjx_A 357 4-hydroxyphenylpyruvate dioxygenase; oxidoreductas 99.54
3oms_A138 PHNB protein; structural genomics, PSI-2, protein 99.5
1sqd_A424 4-hydroxyphenylpyruvate dioxygenase; oxidoreductas 99.49
1sp8_A418 4-hydroxyphenylpyruvate dioxygenase; oxidoreductas 99.46
3isq_A393 4-hydroxyphenylpyruvate dioxygenase; tyrosine meta 99.43
3e0r_A 244 C3-degrading proteinase (CPPA protein); MCSG, PSI, 99.39
1u69_A163 Hypothetical protein; structural genomics, MSCG, p 98.87
3p8a_A 274 Uncharacterized protein; mainly antiparallel beta 98.7
3opy_B 941 6-phosphofructo-1-kinase beta-subunit; ATP binding 98.54
3e0r_A244 C3-degrading proteinase (CPPA protein); MCSG, PSI, 97.5
3pkv_A252 Toxoflavin lyase (TFLA); metalloenzyme, vicinal ox 97.39
3p8a_A274 Uncharacterized protein; mainly antiparallel beta 96.04
3opy_A 989 6-phosphofructo-1-kinase alpha-subunit; ATP bindin 95.99
3oa4_A161 Glyoxalase, BH1468 protein; structural genomics, p 95.94
1xqa_A113 Glyoxalase/bleomycin resistance protein; dioxygena 95.61
3kol_A156 Oxidoreductase, glyoxalase/bleomycin resistance pr 95.46
3e5d_A127 Putative glyoxalase I; structural genomics, joint 95.2
3rmu_A134 Methylmalonyl-COA epimerase, mitochondrial; struct 94.92
3l7t_A134 SMU.1112C, putative uncharacterized protein; metal 94.85
3hdp_A133 Glyoxalase-I; glutathione,lyase, methylglyoxal,110 94.78
3ghj_A141 Putative integron gene cassette protein; integron 94.67
1jc4_A148 Methylmalonyl-COA epimerase; vicinal oxygen chelat 94.58
3gm5_A159 Lactoylglutathione lyase and related lyases; sheet 94.51
1ss4_A153 Glyoxalase family protein; structural genomics, PS 94.01
2a4x_A138 Mitomycin-binding protein; ALFA/beta protein, mito 94.0
3vw9_A187 Lactoylglutathione lyase; glyoxalase, lyase-lyase 93.23
2p25_A126 Glyoxalase family protein; structural genomics, MC 93.12
3g12_A128 Putative lactoylglutathione lyase; glyoxalase, ble 92.98
1f9z_A135 Glyoxalase I; beta-alpha-beta-BETA-beta motif, pro 92.66
4g6x_A155 Glyoxalase/bleomycin resistance protein/dioxygena; 92.29
2za0_A184 Glyoxalase I; lyase, lactoylglutathione lyase, met 92.16
3iuz_A340 Putative glyoxalase superfamily protein; struct ge 92.1
4hc5_A133 Glyoxalase/bleomycin resistance protein/dioxygena; 91.95
2rk0_A136 Glyoxalase/bleomycin resistance protein/dioxygena; 91.68
3huh_A152 Virulence protein STM3117; structural genomics, ny 91.61
2c21_A144 Trypanothione-dependent glyoxalase I; lyase, gluta 91.38
3sk2_A132 EHPR; antibiotic resistance, griseoluteate-binding 91.25
3ey7_A133 Biphenyl-2,3-DIOL 1,2-dioxygenase III-related prot 90.99
3bqx_A150 Glyoxalase-related enzyme; VOC superfamily, PSI-2, 90.77
2kjz_A144 ATC0852; protein of unknown function, dimer, struc 90.6
3uh9_A145 Metallothiol transferase FOSB 2; structural genomi 90.25
3rhe_A148 NAD-dependent benzaldehyde dehydrogenase; structur 89.96
4gym_A149 Glyoxalase/bleomycin resistance protein/dioxygena; 89.75
1k4n_A192 Protein EC4020, protein YECM; structural genomics, 89.4
3ct8_A146 Protein BH2160, putative glyoxalase; NP_243026.1, 89.01
3zw5_A147 Glyoxalase domain-containing protein 5; lyase; 1.6 88.76
2qqz_A126 Glyoxalase family protein, putative; alpha-beta st 88.47
3r6a_A144 Uncharacterized protein; PSI biology, structural g 88.34
2pjs_A119 AGR_C_3564P, uncharacterized protein ATU1953; glyo 88.26
1r9c_A139 Glutathione transferase; fosfomycin resistance pro 87.73
2g3a_A152 Acetyltransferase; structural genomics, PSI, prote 85.67
3r4q_A160 Lactoylglutathione lyase; structural genomics, PSI 85.51
1npb_A141 Fosfomycin-resistance protein; manganese binding, 85.46
1nki_A135 Probable fosfomycin resistance protein; potassium 85.34
2i7r_A118 Conserved domain protein; structural genomics cons 84.62
2rbb_A141 Glyoxalase/bleomycin resistance protein/dioxygena; 83.36
2qnt_A141 AGR_C_3434P, uncharacterized protein ATU1872; glyo 82.74
3m2o_A164 Glyoxalase/bleomycin resistance protein; unknown f 82.54
3lho_A267 Putative hydrolase; structural genomics, joint cen 81.73
2r6u_A148 Uncharacterized protein; structural genomics, PSI- 81.37
2p7o_A133 Glyoxalase family protein; fosfomycin resistance p 80.72
>3l7t_A SMU.1112C, putative uncharacterized protein; metal binding protein; 1.80A {Streptococcus mutans} Back     alignment and structure
Probab=99.95  E-value=3.1e-27  Score=142.78  Aligned_cols=123  Identities=25%  Similarity=0.329  Sum_probs=97.1

Q ss_pred             ceeeeeeeEEEEeCCHHHHHHHHHHhhCCeeeccCCCCCCCeeEEEEEeCCeEEEEee-------cCCCCCCCCCCCCCC
Q 032565           13 YGVVSVHHVGILCENLERSLEFYQNILGLEINEARPHDKLPYRGAWLWVGAEMIHLME-------LPNPDPLSGRPEHGG   85 (138)
Q Consensus        13 ~~~~~l~hi~l~v~d~~~a~~fy~~~lg~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~-------~~~~~~~~~~~~~~~   85 (138)
                      |++++++|+.|.|+|++++++||+++|||++.............+++..++..++++.       ..........+....
T Consensus         1 M~i~~i~hv~l~v~D~~~a~~FY~~~lG~~~~~~~~~~~~~~~~~~~~~~~~~l~l~~~~~~~~~~~~~~~~~~~~~~~~   80 (134)
T 3l7t_A            1 MKLKAVHHVALIVSDYDKSYEFYVNQLGFEVIRENHRPKRHDYKLDLKCGDIELEIFGNKLTDSNYCAPPERISWPREAC   80 (134)
T ss_dssp             -CCCEEEEEEEECSCHHHHHHHHHHTSCCEEEEEEEETTTTEEEEEEEETTEEEEEEECCTTSTTCCCCCCCCCSSSCCS
T ss_pred             CceeeEeEEEEEeCCHHHHHHHHHHhcCCEEEEEeecCCCcceEEEEecCCeEEEEEecccccccccCCccccCCCCCCC
Confidence            5788999999999999999999999999999876543333334677888888999987       332222222222456


Q ss_pred             CCceEEEEECCHHHHHHHHHHCCCeEEec----CCCccEEEEECCCCCeEEEEe
Q 032565           86 RDRHTCIAIRDVSKLKMILDKAGISYTLS----KSGRPAIFTRDPDANALEFTQ  135 (138)
Q Consensus        86 ~~~hi~~~v~d~~~~~~~l~~~g~~~~~~----~~~~~~~~~~DPdG~~~e~~~  135 (138)
                      +..|++|.|+|++++.++|+++|+++...    .++.+.++++|||||.|||+|
T Consensus        81 g~~~~~~~v~d~~~~~~~l~~~G~~~~~~~~~~~~g~~~~~~~DPdG~~iel~e  134 (134)
T 3l7t_A           81 GLRHLAFYVEDVEASRQELIALGIRVEEVRYDDYTGKKMAFFFDPDGLPLELHE  134 (134)
T ss_dssp             EEEEEEEECSCHHHHHHHHHHHTCCCCCCEECTTSCCEEEEEECTTCCEEEEEC
T ss_pred             CeEEEEEEECCHHHHHHHHHhCCCcccceeccCCCceEEEEEECCCCCEEEEeC
Confidence            77899999999999999999999988644    456789999999999999986



>2p25_A Glyoxalase family protein; structural genomics, MCSG, PSI-2, protein struct initiative, midwest center for structural genomics, oxidore; 1.70A {Enterococcus faecalis} Back     alignment and structure
>3kol_A Oxidoreductase, glyoxalase/bleomycin resistance protein/dioxygenase; metal ION binding, NYSGXRC, PSI2, structural genomics; 1.90A {Nostoc punctiforme pcc 73102} Back     alignment and structure
>3ey7_A Biphenyl-2,3-DIOL 1,2-dioxygenase III-related protein; integron cassette protein mobIle metagenome structural genomics, oxidoreductase, PSI-2; HET: MSE; 1.60A {Vibrio cholerae} PDB: 3ey8_A* Back     alignment and structure
>3hdp_A Glyoxalase-I; glutathione,lyase, methylglyoxal,11003P,PSI2, structural GENOMIC,NYSGXRC., structural genomics; 2.06A {Clostridium acetobutylicum} PDB: 2qh0_A Back     alignment and structure
>2qqz_A Glyoxalase family protein, putative; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; HET: MSE; 1.92A {Bacillus anthracis str} Back     alignment and structure
>3rmu_A Methylmalonyl-COA epimerase, mitochondrial; structural genomics consortium, SGC, vitamin B12, mitochondr isomerase; HET: PG4; 1.80A {Homo sapiens} SCOP: d.32.1.0 Back     alignment and structure
>2rk0_A Glyoxalase/bleomycin resistance protein/dioxygena; 11002Z, glyoxylase, dioxygenas PSI-II; 2.04A {Frankia SP} Back     alignment and structure
>2c21_A Trypanothione-dependent glyoxalase I; lyase, glutathionylspermidine, methylglyoxal, detoxification; 2.0A {Leishmania major} SCOP: d.32.1.1 Back     alignment and structure
>3huh_A Virulence protein STM3117; structural genomics, nysgrc, target 13955A1BCT15P1, dioxygen virulence, PSI-2, protein structure initiative; 1.50A {Salmonella enterica subsp} PDB: 3hnq_A Back     alignment and structure
>3e5d_A Putative glyoxalase I; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, lyase; 2.70A {Listeria monocytogenes str} Back     alignment and structure
>3gm5_A Lactoylglutathione lyase and related lyases; sheet-helix-sheet-sheet-sheet motif, isomerase; HET: CIT; 2.00A {Thermoanaerobacter tengcongensis} Back     alignment and structure
>3oa4_A Glyoxalase, BH1468 protein; structural genomics, protein structure initiative, glyoxalas PSI-biology, lyase; 1.94A {Bacillus halodurans} Back     alignment and structure
>4g6x_A Glyoxalase/bleomycin resistance protein/dioxygena; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 1.73A {Catenulispora acidiphila} Back     alignment and structure
>1f9z_A Glyoxalase I; beta-alpha-beta-BETA-beta motif, protein-NI(II) complex, homodimer, lyase; 1.50A {Escherichia coli} SCOP: d.32.1.1 PDB: 1fa5_A 1fa6_A 1fa7_A 1fa8_A Back     alignment and structure
>1nki_A Probable fosfomycin resistance protein; potassium binding loop, manganese binding, transferase; 0.95A {Pseudomonas aeruginosa} SCOP: d.32.1.2 PDB: 1lqo_A 1lqk_A 1lqp_A 1nnr_A Back     alignment and structure
>3zw5_A Glyoxalase domain-containing protein 5; lyase; 1.60A {Homo sapiens} Back     alignment and structure
>1ss4_A Glyoxalase family protein; structural genomics, PSI, prote structure initiative, midwest center for structural genomic unknown function; HET: CIT GSH; 1.84A {Bacillus cereus} SCOP: d.32.1.6 Back     alignment and structure
>1npb_A Fosfomycin-resistance protein; manganese binding, potassium binding loop, transferase; 2.50A {Serratia marcescens} SCOP: d.32.1.2 Back     alignment and structure
>2p7o_A Glyoxalase family protein; fosfomycin resistance protein, Mn binding, antibiotic resist metal binding protein, hydrolase; 1.44A {Listeria monocytogenes} PDB: 2p7k_A 2p7l_A 2p7m_A 2p7p_A 2p7q_A Back     alignment and structure
>3vw9_A Lactoylglutathione lyase; glyoxalase, lyase-lyase inhibitor complex; HET: EPE HPJ; 1.47A {Homo sapiens} PDB: 1qip_A* 1fro_A* 1qin_A* 1bh5_A* 2za0_A* Back     alignment and structure
>1r9c_A Glutathione transferase; fosfomycin resistance protein, Mn binding, antibiotic resist transferase; 1.83A {Mesorhizobium loti} SCOP: d.32.1.2 Back     alignment and structure
>3ghj_A Putative integron gene cassette protein; integron cassette protein, mobIle metagenome, structural genomics, PSI-2; 1.47A {Uncultured bacterium} Back     alignment and structure
>3bqx_A Glyoxalase-related enzyme; VOC superfamily, PSI-2, STRU genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; 1.40A {Fulvimarina pelagi} Back     alignment and structure
>3r4q_A Lactoylglutathione lyase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.51A {Agrobacterium tumefaciens} Back     alignment and structure
>4hc5_A Glyoxalase/bleomycin resistance protein/dioxygena; MCSG, GEBA genomes, structural genomics, midwest center for structural genomics; HET: MSE GOL; 1.45A {Sphaerobacter thermophilus} Back     alignment and structure
>3sk2_A EHPR; antibiotic resistance, griseoluteate-binding protein; HET: GRI; 1.01A {Pantoea agglomerans} PDB: 3sk1_A* Back     alignment and structure
>3rhe_A NAD-dependent benzaldehyde dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, SGX; 2.05A {Legionella pneumophila} Back     alignment and structure
>3g12_A Putative lactoylglutathione lyase; glyoxalase, bleomycin resistance, PSI-2, NYSGXRC, structural genomics; 2.58A {Bdellovibrio bacteriovorus HD100} Back     alignment and structure
>1jc4_A Methylmalonyl-COA epimerase; vicinal oxygen chelate superfamily, isomerase; 2.00A {Propionibacterium freudenreichiisubsp} SCOP: d.32.1.4 PDB: 1jc5_A Back     alignment and structure
>2i7r_A Conserved domain protein; structural genomics conserved domain, PSI-2, protein structure initiative; 2.20A {Streptococcus pneumoniae} SCOP: d.32.1.2 Back     alignment and structure
>1xrk_A Bleomycin resistance protein; arm exchange, ligand binding protein, thermostable mutant, antibiotic inhibitor; HET: BLM; 1.50A {Streptoalloteichus hindustanus} SCOP: d.32.1.2 PDB: 2zhp_A* 1byl_A Back     alignment and structure
>2a4x_A Mitomycin-binding protein; ALFA/beta protein, mitomycin C-binding protein, bleomycin A2, antimicrobial protein; HET: BLM; 1.40A {Streptomyces caespitosus} SCOP: d.32.1.2 PDB: 2a4w_A* 1kmz_A 1kll_A* Back     alignment and structure
>2za0_A Glyoxalase I; lyase, lactoylglutathione lyase, methyl- gerfelin; HET: MGI; 1.70A {Mus musculus} PDB: 1qip_A* 1fro_A* 1qin_A* 1bh5_A* Back     alignment and structure
>3rri_A Glyoxalase/bleomycin resistance protein/dioxygena; structural genomics, PSI-biology, midwest center for structu genomics; 1.50A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>2pjs_A AGR_C_3564P, uncharacterized protein ATU1953; glyoxalase/bleomycin resistance protein/dioxygenase superfamily, structural genomics; 1.85A {Agrobacterium tumefaciens str} SCOP: d.32.1.2 Back     alignment and structure
>3itw_A Protein TIOX; bleomycin resistance fold, bisintercalator, solvent-exposed residue, thiocoraline, protein binding, peptide binding Pro; 2.15A {Micromonospora SP} Back     alignment and structure
>2kjz_A ATC0852; protein of unknown function, dimer, structural genomics, PSI protein structure initiative; NMR {Agrobacterium tumefaciens} Back     alignment and structure
>3ct8_A Protein BH2160, putative glyoxalase; NP_243026.1, glyoxalase/bleomycin resis protein/dioxygenase superfamily, structural genomics; HET: UNL; 2.10A {Bacillus halodurans c-125} Back     alignment and structure
>3r6a_A Uncharacterized protein; PSI biology, structural genomics, NEW YORK structural genomi research consortium, putative glyoxalase I; 1.76A {Methanosarcina mazei} Back     alignment and structure
>3fcd_A Lyase, ORF125EGC139; lactoylglutathione lyase, YECM, PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.92A {Uncultured bacterium} SCOP: d.32.1.0 Back     alignment and structure
>2r6u_A Uncharacterized protein; structural genomics, PSI-2, RHA04853, MCSG, protein structur initiative, midwest center for structural genomics; 1.50A {Rhodococcus SP} Back     alignment and structure
>2rbb_A Glyoxalase/bleomycin resistance protein/dioxygena; structural genomics, PSI-2, PROT structure initiative; 1.82A {Burkholderia phytofirmans} Back     alignment and structure
>4gym_A Glyoxalase/bleomycin resistance protein/dioxygena; PSI-biology, midwest center for structural genomics, MCSG, oxidoreductase; HET: MSE; 1.56A {Conexibacter woesei} Back     alignment and structure
>1ecs_A Bleomycin resistance protein; arm-exchange, antibiotic inhibitor; HET: PG4; 1.70A {Klebsiella pneumoniae} SCOP: d.32.1.2 PDB: 1ewj_A* 1niq_B* 1mh6_A Back     alignment and structure
>1qto_A Bleomycin-binding protein; arm-exchange, antibiotic inhibitor; 1.50A {Streptomyces verticillus} SCOP: d.32.1.2 PDB: 1jie_A* 1jif_A Back     alignment and structure
>1xqa_A Glyoxalase/bleomycin resistance protein; dioxygenase, structural GEN midwest center for structural genomics, MCSG; HET: P6G; 1.80A {Bacillus cereus atcc 14579} SCOP: d.32.1.2 Back     alignment and structure
>3oaj_A Putative ring-cleaving dioxygenase MHQO; structural genomics, protein structure initiative, PSI-biolo unknown function; 1.40A {Bacillus subtilis subsp} Back     alignment and structure
>3oaj_A Putative ring-cleaving dioxygenase MHQO; structural genomics, protein structure initiative, PSI-biolo unknown function; 1.40A {Bacillus subtilis subsp} Back     alignment and structure
>2qnt_A AGR_C_3434P, uncharacterized protein ATU1872; glyoxalase/bleomycin resistance protein/dioxygenase family R protein, PSI-2, MCSG; HET: MSE EPE; 1.40A {Agrobacterium tumefaciens str} Back     alignment and structure
>3pkv_A Toxoflavin lyase (TFLA); metalloenzyme, vicinal oxygen chelate superfamily; 1.34A {Paenibacillus polymyxa} PDB: 3pkw_A 3pkx_A* 3oul_A 3oum_A* Back     alignment and structure
>1twu_A Hypothetical protein YYCE; structural genomics, protein structure initiative, MCSG, DUP of the alpha-beta sandwichs. bacillus subtilis, PSI; 2.00A {Bacillus subtilis} SCOP: d.32.1.8 Back     alignment and structure
>2rk9_A Glyoxalase/bleomycin resistance protein/dioxygena; NYSGXRC, structural genomics, protein structur initiative II; 1.60A {Vibrio splendidus} Back     alignment and structure
>1zsw_A Metallo protein, glyoxalase family protein; hypothetical protein from glyoxalase family, structural GENO PSI, protein structure initiative; 1.65A {Bacillus cereus} SCOP: d.32.1.10 d.32.1.10 Back     alignment and structure
>3bt3_A Glyoxalase-related enzyme, ARAC type; VOC superfamily, PSI-2, NYSGXRC, structural genomics, prote structure initiative; 2.50A {Clostridium phytofermentans} Back     alignment and structure
>3lm4_A Catechol 2,3-dioxygenase; NYSGXRC, PSI-II, protein structure initiative, 2hydroxyl 6 OXO 6 phenyl hexa 2-4 dienoic acid, peroxide; HET: HPX; 1.80A {Rhodococcus jostii} Back     alignment and structure
>1zsw_A Metallo protein, glyoxalase family protein; hypothetical protein from glyoxalase family, structural GENO PSI, protein structure initiative; 1.65A {Bacillus cereus} SCOP: d.32.1.10 d.32.1.10 Back     alignment and structure
>1lgt_A Biphenyl-2,3-DIOL 1,2-dioxygenase; extradiol dioxygenase, 2,3-dihydroxybiphenyl, non-heme iron, anaerobic, PCB biodegradation; HET: BP3; 1.70A {Burkholderia xenovorans} SCOP: d.32.1.3 d.32.1.3 PDB: 1kmy_A* 1knd_A 1knf_A 1han_A* 1lkd_A* Back     alignment and structure
>4ghg_A Homoprotocatechuate 2,3-dioxygenase; oxygen activation, Fe(II), 2-His-1-carboxylate triad, 4-nitrocatechol, OXY complex, oxidoreductase; HET: P6G PG4 DHY; 1.50A {Brevibacterium fuscum} PDB: 1q0o_A 1q0c_A 2iga_A* 2ig9_A 3ojj_A* 3bza_A* 3ojk_A* 3ojt_A* 3ojn_A* 4ghh_A* 4ghc_A 4ghd_A* 4ghe_A* 4ghf_A* 3eck_A* 3ecj_A* Back     alignment and structure
>3hpy_A Catechol 2,3-dioxygenase; repeated motifs, aromatic hydrocarbons catabolism, iron, oxidoreductase; 1.94A {Pseudomonas SP} PDB: 3hpv_A 3hq0_A* Back     alignment and structure
>2ehz_A 1,2-dihydroxynaphthalene dioxygenase; extradiol dioxygenase, protein substrate complex, oxidoreduc; 1.35A {Pseudomonas SP} PDB: 2ei0_A* 2ei1_A* 2ei3_A* 2ei2_A Back     alignment and structure
>2zyq_A Probable biphenyl-2,3-DIOL 1,2-dioxygenase BPHC; extradiol, DHSA, TB, catechol, cholesterol, steroid, aromatic hydrocarbons catabolism; HET: TAR; 2.00A {Mycobacterium tuberculosis} PDB: 2zi8_A* Back     alignment and structure
>1kw3_B 2,3-dihydroxybiphenyl dioxygenase; four TIME repetitions of the beta-alpha-beta-BETA-beta motif oxidoreductase; 1.45A {Pseudomonas SP} SCOP: d.32.1.3 d.32.1.3 PDB: 1dhy_A 1eiq_A 1eir_A* 1eil_A 1kw6_B* 1kw8_B* 1kw9_B* 1kwb_B 1kwc_B* Back     alignment and structure
>3hpy_A Catechol 2,3-dioxygenase; repeated motifs, aromatic hydrocarbons catabolism, iron, oxidoreductase; 1.94A {Pseudomonas SP} PDB: 3hpv_A 3hq0_A* Back     alignment and structure
>1f1u_A Homoprotocatechuate 2,3-dioxygenase; extradiol, manganese, biodegradation, aromatic, oxidoreductase; 1.50A {Arthrobacter globiformis} SCOP: d.32.1.3 d.32.1.3 PDB: 1f1r_A 1f1v_A* 1f1x_A Back     alignment and structure
>2wl9_A Catechol 2,3-dioxygenase; aromatic hydrocarbons catabolism, iron, oxidoreductase; 1.90A {Rhodococcus SP} PDB: 2wl3_A Back     alignment and structure
>1mpy_A Catechol 2,3-dioxygenase; extradiol dioxygenase, non heme iron dioxygenase, metapyrocatechase, oxidoreductase; 2.80A {Pseudomonas putida} SCOP: d.32.1.3 d.32.1.3 Back     alignment and structure
>3zi1_A Glyoxalase domain-containing protein 4; isomerase; 1.90A {Homo sapiens} Back     alignment and structure
>3oxh_A RV0577 protein; kinase regulation, antibiotic resistance, mycobacterium tube structural genomics, PSI, protein structure initiative; HET: PMB XYL; 1.75A {Mycobacterium tuberculosis} Back     alignment and structure
>3lm4_A Catechol 2,3-dioxygenase; NYSGXRC, PSI-II, protein structure initiative, 2hydroxyl 6 OXO 6 phenyl hexa 2-4 dienoic acid, peroxide; HET: HPX; 1.80A {Rhodococcus jostii} Back     alignment and structure
>1f1u_A Homoprotocatechuate 2,3-dioxygenase; extradiol, manganese, biodegradation, aromatic, oxidoreductase; 1.50A {Arthrobacter globiformis} SCOP: d.32.1.3 d.32.1.3 PDB: 1f1r_A 1f1v_A* 1f1x_A Back     alignment and structure
>2zyq_A Probable biphenyl-2,3-DIOL 1,2-dioxygenase BPHC; extradiol, DHSA, TB, catechol, cholesterol, steroid, aromatic hydrocarbons catabolism; HET: TAR; 2.00A {Mycobacterium tuberculosis} PDB: 2zi8_A* Back     alignment and structure
>1mpy_A Catechol 2,3-dioxygenase; extradiol dioxygenase, non heme iron dioxygenase, metapyrocatechase, oxidoreductase; 2.80A {Pseudomonas putida} SCOP: d.32.1.3 d.32.1.3 Back     alignment and structure
>3b59_A Glyoxalase/bleomycin resistance protein/dioxygena; 11004Z, NYSGXRC, PSI-2, structural genomics, Pro structure initiative; 2.53A {Novosphingobium aromaticivorans} Back     alignment and structure
>3b59_A Glyoxalase/bleomycin resistance protein/dioxygena; 11004Z, NYSGXRC, PSI-2, structural genomics, Pro structure initiative; 2.53A {Novosphingobium aromaticivorans} Back     alignment and structure
>3zi1_A Glyoxalase domain-containing protein 4; isomerase; 1.90A {Homo sapiens} Back     alignment and structure
>2wl9_A Catechol 2,3-dioxygenase; aromatic hydrocarbons catabolism, iron, oxidoreductase; 1.90A {Rhodococcus SP} PDB: 2wl3_A Back     alignment and structure
>3oxh_A RV0577 protein; kinase regulation, antibiotic resistance, mycobacterium tube structural genomics, PSI, protein structure initiative; HET: PMB XYL; 1.75A {Mycobacterium tuberculosis} Back     alignment and structure
>2r5v_A PCZA361.1; dioxygenase, non-heme iron, vancomycin, oxidoreductase; HET: HHH; 2.30A {Amycolatopsis orientalis} Back     alignment and structure
>2ehz_A 1,2-dihydroxynaphthalene dioxygenase; extradiol dioxygenase, protein substrate complex, oxidoreduc; 1.35A {Pseudomonas SP} PDB: 2ei0_A* 2ei1_A* 2ei3_A* 2ei2_A Back     alignment and structure
>1lgt_A Biphenyl-2,3-DIOL 1,2-dioxygenase; extradiol dioxygenase, 2,3-dihydroxybiphenyl, non-heme iron, anaerobic, PCB biodegradation; HET: BP3; 1.70A {Burkholderia xenovorans} SCOP: d.32.1.3 d.32.1.3 PDB: 1kmy_A* 1knd_A 1knf_A 1han_A* 1lkd_A* Back     alignment and structure
>1kw3_B 2,3-dihydroxybiphenyl dioxygenase; four TIME repetitions of the beta-alpha-beta-BETA-beta motif oxidoreductase; 1.45A {Pseudomonas SP} SCOP: d.32.1.3 d.32.1.3 PDB: 1dhy_A 1eiq_A 1eir_A* 1eil_A 1kw6_B* 1kw8_B* 1kw9_B* 1kwb_B 1kwc_B* Back     alignment and structure
>1xy7_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G48480, reductively methylated protein, CATH 3.10.180 fold; 1.80A {Arabidopsis thaliana} SCOP: d.32.1.9 PDB: 2q48_A Back     alignment and structure
>2zw5_A Bleomycin acetyltransferase; dimer, two domains; HET: COA; 2.40A {Streptomyces verticillus} PDB: 2zw4_A* 2zw6_A 2zw7_A* Back     alignment and structure
>1u6l_A Hypothetical protein; structural genomics, PSI, protein STRU initiative, NEW YORK SGX research center for structural GEN nysgxrc; 2.81A {Pseudomonas aeruginosa} SCOP: d.32.1.7 Back     alignment and structure
>4ghg_A Homoprotocatechuate 2,3-dioxygenase; oxygen activation, Fe(II), 2-His-1-carboxylate triad, 4-nitrocatechol, OXY complex, oxidoreductase; HET: P6G PG4 DHY; 1.50A {Brevibacterium fuscum} PDB: 1q0o_A 1q0c_A 2iga_A* 2ig9_A 3ojj_A* 3bza_A* 3ojk_A* 3ojt_A* 3ojn_A* 4ghh_A* 4ghc_A 4ghd_A* 4ghe_A* 4ghf_A* 3eck_A* 3ecj_A* Back     alignment and structure
>1t47_A 4-hydroxyphenylpyruvate dioxygenase; triketone inhibitor, iron, oxidoreductase; HET: NTD; 2.50A {Streptomyces avermitilis} SCOP: d.32.1.3 d.32.1.3 Back     alignment and structure
>1sqd_A 4-hydroxyphenylpyruvate dioxygenase; oxidoreductase; 1.80A {Arabidopsis thaliana} SCOP: d.32.1.3 d.32.1.3 PDB: 1tfz_A* 1tg5_A* 1sp9_A Back     alignment and structure
>2r5v_A PCZA361.1; dioxygenase, non-heme iron, vancomycin, oxidoreductase; HET: HHH; 2.30A {Amycolatopsis orientalis} Back     alignment and structure
>1u7i_A Hypothetical protein; structural genomics, PA1358, PSI, PROT structure initiative; HET: MSE; 1.40A {Pseudomonas aeruginosa} SCOP: d.32.1.7 Back     alignment and structure
>1tsj_A Conserved hypothetical protein; structural genomics, protein structure initiative, PSI, nysgxrc; 2.60A {Staphylococcus aureus subsp} SCOP: d.32.1.7 Back     alignment and structure
>1t47_A 4-hydroxyphenylpyruvate dioxygenase; triketone inhibitor, iron, oxidoreductase; HET: NTD; 2.50A {Streptomyces avermitilis} SCOP: d.32.1.3 d.32.1.3 Back     alignment and structure
>1sp8_A 4-hydroxyphenylpyruvate dioxygenase; oxidoreductase; 2.00A {Zea mays} SCOP: d.32.1.3 d.32.1.3 Back     alignment and structure
>3isq_A 4-hydroxyphenylpyruvate dioxygenase; tyrosine metabolism, DIS mutation, iron, mental retardation, metal-binding, oxidored phenylalanine catabolism; 1.75A {Homo sapiens} PDB: 1sqi_A* Back     alignment and structure
>3l20_A Putative uncharacterized protein; hypothetical protein, unknown function; 2.45A {Staphylococcus aureus} Back     alignment and structure
>1cjx_A 4-hydroxyphenylpyruvate dioxygenase; oxidoreductase, iron; 2.40A {Pseudomonas fluorescens} SCOP: d.32.1.3 d.32.1.3 Back     alignment and structure
>1cjx_A 4-hydroxyphenylpyruvate dioxygenase; oxidoreductase, iron; 2.40A {Pseudomonas fluorescens} SCOP: d.32.1.3 d.32.1.3 Back     alignment and structure
>3oms_A PHNB protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, methyltransferase, GL family; 1.90A {Bacillus cereus} SCOP: d.32.1.0 Back     alignment and structure
>1sqd_A 4-hydroxyphenylpyruvate dioxygenase; oxidoreductase; 1.80A {Arabidopsis thaliana} SCOP: d.32.1.3 d.32.1.3 PDB: 1tfz_A* 1tg5_A* 1sp9_A Back     alignment and structure
>1sp8_A 4-hydroxyphenylpyruvate dioxygenase; oxidoreductase; 2.00A {Zea mays} SCOP: d.32.1.3 d.32.1.3 Back     alignment and structure
>3isq_A 4-hydroxyphenylpyruvate dioxygenase; tyrosine metabolism, DIS mutation, iron, mental retardation, metal-binding, oxidored phenylalanine catabolism; 1.75A {Homo sapiens} PDB: 1sqi_A* Back     alignment and structure
>3e0r_A C3-degrading proteinase (CPPA protein); MCSG, PSI, SAD, structural GE protein structure initiative; 2.30A {Streptococcus pneumoniae} Back     alignment and structure
>1u69_A Hypothetical protein; structural genomics, MSCG, pseudomonas aeruginosa PAO1, HYPO protein, protein structure initiative (PSI); 1.60A {Pseudomonas aeruginosa} SCOP: d.32.1.7 Back     alignment and structure
>3p8a_A Uncharacterized protein; mainly antiparallel beta sheets, alpha and beta protein, UNK function; HET: MSE BTB PG4; 1.95A {Staphylococcus aureus} Back     alignment and structure
>3opy_B 6-phosphofructo-1-kinase beta-subunit; ATP binding, fructose-6-phosphate bindi magnesium binding, citrate binding, ADP binding; HET: ATP; 3.05A {Pichia pastoris} Back     alignment and structure
>3e0r_A C3-degrading proteinase (CPPA protein); MCSG, PSI, SAD, structural GE protein structure initiative; 2.30A {Streptococcus pneumoniae} Back     alignment and structure
>3pkv_A Toxoflavin lyase (TFLA); metalloenzyme, vicinal oxygen chelate superfamily; 1.34A {Paenibacillus polymyxa} PDB: 3pkw_A 3pkx_A* 3oul_A 3oum_A* Back     alignment and structure
>3p8a_A Uncharacterized protein; mainly antiparallel beta sheets, alpha and beta protein, UNK function; HET: MSE BTB PG4; 1.95A {Staphylococcus aureus} Back     alignment and structure
>3opy_A 6-phosphofructo-1-kinase alpha-subunit; ATP binding, fructose-6-phosphate bindi magnesium binding, citrate binding, ADP binding; HET: ATP; 3.05A {Pichia pastoris} Back     alignment and structure
>3oa4_A Glyoxalase, BH1468 protein; structural genomics, protein structure initiative, glyoxalas PSI-biology, lyase; 1.94A {Bacillus halodurans} Back     alignment and structure
>1xqa_A Glyoxalase/bleomycin resistance protein; dioxygenase, structural GEN midwest center for structural genomics, MCSG; HET: P6G; 1.80A {Bacillus cereus atcc 14579} SCOP: d.32.1.2 Back     alignment and structure
>3kol_A Oxidoreductase, glyoxalase/bleomycin resistance protein/dioxygenase; metal ION binding, NYSGXRC, PSI2, structural genomics; 1.90A {Nostoc punctiforme pcc 73102} Back     alignment and structure
>3e5d_A Putative glyoxalase I; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, lyase; 2.70A {Listeria monocytogenes str} Back     alignment and structure
>3rmu_A Methylmalonyl-COA epimerase, mitochondrial; structural genomics consortium, SGC, vitamin B12, mitochondr isomerase; HET: PG4; 1.80A {Homo sapiens} SCOP: d.32.1.0 Back     alignment and structure
>3l7t_A SMU.1112C, putative uncharacterized protein; metal binding protein; 1.80A {Streptococcus mutans} Back     alignment and structure
>3hdp_A Glyoxalase-I; glutathione,lyase, methylglyoxal,11003P,PSI2, structural GENOMIC,NYSGXRC., structural genomics; 2.06A {Clostridium acetobutylicum} PDB: 2qh0_A Back     alignment and structure
>3ghj_A Putative integron gene cassette protein; integron cassette protein, mobIle metagenome, structural genomics, PSI-2; 1.47A {Uncultured bacterium} Back     alignment and structure
>1jc4_A Methylmalonyl-COA epimerase; vicinal oxygen chelate superfamily, isomerase; 2.00A {Propionibacterium freudenreichiisubsp} SCOP: d.32.1.4 PDB: 1jc5_A Back     alignment and structure
>3gm5_A Lactoylglutathione lyase and related lyases; sheet-helix-sheet-sheet-sheet motif, isomerase; HET: CIT; 2.00A {Thermoanaerobacter tengcongensis} Back     alignment and structure
>1ss4_A Glyoxalase family protein; structural genomics, PSI, prote structure initiative, midwest center for structural genomic unknown function; HET: CIT GSH; 1.84A {Bacillus cereus} SCOP: d.32.1.6 Back     alignment and structure
>2a4x_A Mitomycin-binding protein; ALFA/beta protein, mitomycin C-binding protein, bleomycin A2, antimicrobial protein; HET: BLM; 1.40A {Streptomyces caespitosus} SCOP: d.32.1.2 PDB: 2a4w_A* 1kmz_A 1kll_A* Back     alignment and structure
>3vw9_A Lactoylglutathione lyase; glyoxalase, lyase-lyase inhibitor complex; HET: EPE HPJ; 1.47A {Homo sapiens} PDB: 1qip_A* 1fro_A* 1qin_A* 1bh5_A* 2za0_A* Back     alignment and structure
>2p25_A Glyoxalase family protein; structural genomics, MCSG, PSI-2, protein struct initiative, midwest center for structural genomics, oxidore; 1.70A {Enterococcus faecalis} Back     alignment and structure
>3g12_A Putative lactoylglutathione lyase; glyoxalase, bleomycin resistance, PSI-2, NYSGXRC, structural genomics; 2.58A {Bdellovibrio bacteriovorus HD100} Back     alignment and structure
>1f9z_A Glyoxalase I; beta-alpha-beta-BETA-beta motif, protein-NI(II) complex, homodimer, lyase; 1.50A {Escherichia coli} SCOP: d.32.1.1 PDB: 1fa5_A 1fa6_A 1fa7_A 1fa8_A Back     alignment and structure
>4g6x_A Glyoxalase/bleomycin resistance protein/dioxygena; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 1.73A {Catenulispora acidiphila} Back     alignment and structure
>2za0_A Glyoxalase I; lyase, lactoylglutathione lyase, methyl- gerfelin; HET: MGI; 1.70A {Mus musculus} PDB: 1qip_A* 1fro_A* 1qin_A* 1bh5_A* Back     alignment and structure
>3iuz_A Putative glyoxalase superfamily protein; struct genomics, joint center for structural genomics, JCSG, prote structure initiative, PSI-2; HET: MLY P6G PGE; 1.90A {Ralstonia eutropha} Back     alignment and structure
>4hc5_A Glyoxalase/bleomycin resistance protein/dioxygena; MCSG, GEBA genomes, structural genomics, midwest center for structural genomics; HET: MSE GOL; 1.45A {Sphaerobacter thermophilus} Back     alignment and structure
>2rk0_A Glyoxalase/bleomycin resistance protein/dioxygena; 11002Z, glyoxylase, dioxygenas PSI-II; 2.04A {Frankia SP} Back     alignment and structure
>3huh_A Virulence protein STM3117; structural genomics, nysgrc, target 13955A1BCT15P1, dioxygen virulence, PSI-2, protein structure initiative; 1.50A {Salmonella enterica subsp} PDB: 3hnq_A Back     alignment and structure
>2c21_A Trypanothione-dependent glyoxalase I; lyase, glutathionylspermidine, methylglyoxal, detoxification; 2.0A {Leishmania major} SCOP: d.32.1.1 Back     alignment and structure
>3sk2_A EHPR; antibiotic resistance, griseoluteate-binding protein; HET: GRI; 1.01A {Pantoea agglomerans} PDB: 3sk1_A* Back     alignment and structure
>3ey7_A Biphenyl-2,3-DIOL 1,2-dioxygenase III-related protein; integron cassette protein mobIle metagenome structural genomics, oxidoreductase, PSI-2; HET: MSE; 1.60A {Vibrio cholerae} PDB: 3ey8_A* Back     alignment and structure
>3bqx_A Glyoxalase-related enzyme; VOC superfamily, PSI-2, STRU genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; 1.40A {Fulvimarina pelagi} Back     alignment and structure
>2kjz_A ATC0852; protein of unknown function, dimer, structural genomics, PSI protein structure initiative; NMR {Agrobacterium tumefaciens} Back     alignment and structure
>3rhe_A NAD-dependent benzaldehyde dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, SGX; 2.05A {Legionella pneumophila} Back     alignment and structure
>4gym_A Glyoxalase/bleomycin resistance protein/dioxygena; PSI-biology, midwest center for structural genomics, MCSG, oxidoreductase; HET: MSE; 1.56A {Conexibacter woesei} Back     alignment and structure
>1k4n_A Protein EC4020, protein YECM; structural genomics, A NEW fold of protein, PSI, protein structure initiative; 1.60A {Escherichia coli} SCOP: d.32.1.5 Back     alignment and structure
>3ct8_A Protein BH2160, putative glyoxalase; NP_243026.1, glyoxalase/bleomycin resis protein/dioxygenase superfamily, structural genomics; HET: UNL; 2.10A {Bacillus halodurans c-125} Back     alignment and structure
>3zw5_A Glyoxalase domain-containing protein 5; lyase; 1.60A {Homo sapiens} Back     alignment and structure
>2qqz_A Glyoxalase family protein, putative; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; HET: MSE; 1.92A {Bacillus anthracis str} Back     alignment and structure
>3r6a_A Uncharacterized protein; PSI biology, structural genomics, NEW YORK structural genomi research consortium, putative glyoxalase I; 1.76A {Methanosarcina mazei} Back     alignment and structure
>2pjs_A AGR_C_3564P, uncharacterized protein ATU1953; glyoxalase/bleomycin resistance protein/dioxygenase superfamily, structural genomics; 1.85A {Agrobacterium tumefaciens str} SCOP: d.32.1.2 Back     alignment and structure
>1r9c_A Glutathione transferase; fosfomycin resistance protein, Mn binding, antibiotic resist transferase; 1.83A {Mesorhizobium loti} SCOP: d.32.1.2 Back     alignment and structure
>2g3a_A Acetyltransferase; structural genomics, PSI, protein structu initiative, midwest center for structural genomics, MCSG; 1.90A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 Back     alignment and structure
>3r4q_A Lactoylglutathione lyase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.51A {Agrobacterium tumefaciens} Back     alignment and structure
>1npb_A Fosfomycin-resistance protein; manganese binding, potassium binding loop, transferase; 2.50A {Serratia marcescens} SCOP: d.32.1.2 Back     alignment and structure
>1nki_A Probable fosfomycin resistance protein; potassium binding loop, manganese binding, transferase; 0.95A {Pseudomonas aeruginosa} SCOP: d.32.1.2 PDB: 1lqo_A 1lqk_A 1lqp_A 1nnr_A Back     alignment and structure
>2i7r_A Conserved domain protein; structural genomics conserved domain, PSI-2, protein structure initiative; 2.20A {Streptococcus pneumoniae} SCOP: d.32.1.2 Back     alignment and structure
>2rbb_A Glyoxalase/bleomycin resistance protein/dioxygena; structural genomics, PSI-2, PROT structure initiative; 1.82A {Burkholderia phytofirmans} Back     alignment and structure
>2qnt_A AGR_C_3434P, uncharacterized protein ATU1872; glyoxalase/bleomycin resistance protein/dioxygenase family R protein, PSI-2, MCSG; HET: MSE EPE; 1.40A {Agrobacterium tumefaciens str} Back     alignment and structure
>3lho_A Putative hydrolase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: PG4; 1.80A {Shewanella frigidimarina} Back     alignment and structure
>2r6u_A Uncharacterized protein; structural genomics, PSI-2, RHA04853, MCSG, protein structur initiative, midwest center for structural genomics; 1.50A {Rhodococcus SP} Back     alignment and structure
>2p7o_A Glyoxalase family protein; fosfomycin resistance protein, Mn binding, antibiotic resist metal binding protein, hydrolase; 1.44A {Listeria monocytogenes} PDB: 2p7k_A 2p7l_A 2p7m_A 2p7p_A 2p7q_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 138
d1zswa1144 d.32.1.10 (A:1-144) Hypothetical protein BC1024 {B 9e-14
d2c21a1139 d.32.1.1 (A:3-141) Glyoxalase I (lactoylglutathion 9e-14
d1f9za_135 d.32.1.1 (A:) Glyoxalase I (lactoylglutathione lya 7e-12
d1r9ca_130 d.32.1.2 (A:) Fosfomycin resistance protein FosX { 2e-11
d1nkia_134 d.32.1.2 (A:) Fosfomycin resistance protein A (Fos 2e-10
d1qipa_176 d.32.1.1 (A:) Glyoxalase I (lactoylglutathione lya 3e-10
d1npba_140 d.32.1.2 (A:) Fosfomycin resistance protein A (Fos 6e-10
d1mpya2162 d.32.1.3 (A:146-307) Catechol 2,3-dioxygenase (met 7e-10
d1zswa2170 d.32.1.10 (A:145-314) Hypothetical protein BC1024 2e-09
d1f1ua2176 d.32.1.3 (A:148-323) Homoprotocatechuate 2,3-dioxy 3e-09
d1xrka_120 d.32.1.2 (A:) Bleomycin resistance protein, BRP {S 1e-08
d1xqaa_113 d.32.1.2 (A:) Hypothetical protein BC3580 {Bacillu 1e-07
d2i7ra1115 d.32.1.2 (A:1-115) Hypotheical protein SP0731 {Str 1e-07
d1jc4a_145 d.32.1.4 (A:) Methylmalonyl-CoA epimerase {Propion 2e-07
d1twua_137 d.32.1.8 (A:) Hypothetical protein YycE {Bacillus 2e-07
d1sqia1149 d.32.1.3 (A:8-156) 4-hydroxyphenylpyruvate dioxyge 5e-07
d1mpya1145 d.32.1.3 (A:1-145) Catechol 2,3-dioxygenase (metap 5e-07
d1ss4a_149 d.32.1.6 (A:) Hypothetical protein BC1747 {Bacillu 6e-07
d1klla_128 d.32.1.2 (A:) Mitomycin resistance protein D, MRD 9e-07
d1sp8a2224 d.32.1.3 (A:208-431) 4-hydroxyphenylpyruvate dioxy 2e-06
d1lgta1131 d.32.1.3 (A:2-132) 2,3-Dihydroxybiphenyl dioxygena 3e-06
d1f1ua1146 d.32.1.3 (A:2-147) Homoprotocatechuate 2,3-dioxyge 5e-06
d1t47a1163 d.32.1.3 (A:16-178) 4-hydroxyphenylpyruvate dioxyg 7e-06
d1sp8a1172 d.32.1.3 (A:36-207) 4-hydroxyphenylpyruvate dioxyg 3e-05
d1kw3b2156 d.32.1.3 (B:133-288) 2,3-Dihydroxybiphenyl dioxyge 5e-05
d1kw3b1132 d.32.1.3 (B:1-132) 2,3-Dihydroxybiphenyl dioxygena 8e-05
d2pjsa1111 d.32.1.2 (A:3-113) Uncharacterized protein Atu1953 1e-04
d1jifa_122 d.32.1.2 (A:) Bleomycin resistance protein, BRP {S 1e-04
d1ecsa_120 d.32.1.2 (A:) Bleomycin resistance protein, BRP {K 2e-04
d1sqda1167 d.32.1.3 (A:14-180) 4-hydroxyphenylpyruvate dioxyg 5e-04
>d1zswa1 d.32.1.10 (A:1-144) Hypothetical protein BC1024 {Bacillus cereus [TaxId: 1396]} Length = 144 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase
superfamily: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase
family: BC1024-like
domain: Hypothetical protein BC1024
species: Bacillus cereus [TaxId: 1396]
 Score = 62.0 bits (149), Expect = 9e-14
 Identities = 23/133 (17%), Positives = 46/133 (34%), Gaps = 7/133 (5%)

Query: 13  YGVVSVHHVGILCENLERSLEFYQNILGLEINEARPHDKLPYRGAWLWV---GAEMIHLM 69
           Y +   HH+ ++ +N   +  FY+N+LGL   +   +   P      +    G+    L 
Sbjct: 2   YEIKGHHHISMVTKNANENNHFYKNVLGLRRVKMTVNQDDPSMYHLFYGDKTGSPGTELS 61

Query: 70  ELPNPDPLSGRPEHGGRDR--HTCIAIRDVSKLKMILDKAGISYT--LSKSGRPAIFTRD 125
               P             R      +   +   K   +K  + ++   + + RPA+   D
Sbjct: 62  FFEIPLVGRTYRGTNAITRIGLLVPSEDSLHYWKERFEKFDVKHSEMTTYANRPALQFED 121

Query: 126 PDANALEFTQVDG 138
            +   L     +G
Sbjct: 122 AEGLRLVLLVSNG 134


>d2c21a1 d.32.1.1 (A:3-141) Glyoxalase I (lactoylglutathione lyase) {Leishmania major [TaxId: 5664]} Length = 139 Back     information, alignment and structure
>d1f9za_ d.32.1.1 (A:) Glyoxalase I (lactoylglutathione lyase) {Escherichia coli [TaxId: 562]} Length = 135 Back     information, alignment and structure
>d1r9ca_ d.32.1.2 (A:) Fosfomycin resistance protein FosX {Mesorhizobium loti [TaxId: 381]} Length = 130 Back     information, alignment and structure
>d1nkia_ d.32.1.2 (A:) Fosfomycin resistance protein A (FosA) {Pseudomonas aeruginosa [TaxId: 287]} Length = 134 Back     information, alignment and structure
>d1qipa_ d.32.1.1 (A:) Glyoxalase I (lactoylglutathione lyase) {Human (Homo sapiens) [TaxId: 9606]} Length = 176 Back     information, alignment and structure
>d1npba_ d.32.1.2 (A:) Fosfomycin resistance protein A (FosA) {Serratia marcescens [TaxId: 615]} Length = 140 Back     information, alignment and structure
>d1mpya2 d.32.1.3 (A:146-307) Catechol 2,3-dioxygenase (metapyrocatechase) {Pseudomonas putida, mt2 [TaxId: 303]} Length = 162 Back     information, alignment and structure
>d1zswa2 d.32.1.10 (A:145-314) Hypothetical protein BC1024 {Bacillus cereus [TaxId: 1396]} Length = 170 Back     information, alignment and structure
>d1f1ua2 d.32.1.3 (A:148-323) Homoprotocatechuate 2,3-dioxygenase {Arthrobacter globiformis [TaxId: 1665]} Length = 176 Back     information, alignment and structure
>d1xrka_ d.32.1.2 (A:) Bleomycin resistance protein, BRP {Streptoalloteichus hindustanus [TaxId: 2017]} Length = 120 Back     information, alignment and structure
>d1xqaa_ d.32.1.2 (A:) Hypothetical protein BC3580 {Bacillus cereus [TaxId: 1396]} Length = 113 Back     information, alignment and structure
>d2i7ra1 d.32.1.2 (A:1-115) Hypotheical protein SP0731 {Streptococcus pneumoniae [TaxId: 1313]} Length = 115 Back     information, alignment and structure
>d1jc4a_ d.32.1.4 (A:) Methylmalonyl-CoA epimerase {Propionibacterium shermanii [TaxId: 1752]} Length = 145 Back     information, alignment and structure
>d1twua_ d.32.1.8 (A:) Hypothetical protein YycE {Bacillus subtilis [TaxId: 1423]} Length = 137 Back     information, alignment and structure
>d1sqia1 d.32.1.3 (A:8-156) 4-hydroxyphenylpyruvate dioxygenase, HppD {Human (Homo sapiens) [TaxId: 9606]} Length = 149 Back     information, alignment and structure
>d1mpya1 d.32.1.3 (A:1-145) Catechol 2,3-dioxygenase (metapyrocatechase) {Pseudomonas putida, mt2 [TaxId: 303]} Length = 145 Back     information, alignment and structure
>d1ss4a_ d.32.1.6 (A:) Hypothetical protein BC1747 {Bacillus cereus (strain ATCC 14579 / DSM 31) [TaxId: 226900]} Length = 149 Back     information, alignment and structure
>d1klla_ d.32.1.2 (A:) Mitomycin resistance protein D, MRD {Streptomyces lavendulae [TaxId: 1914]} Length = 128 Back     information, alignment and structure
>d1sp8a2 d.32.1.3 (A:208-431) 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Zea mays) [TaxId: 4577]} Length = 224 Back     information, alignment and structure
>d1lgta1 d.32.1.3 (A:2-132) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Burkholderia cepacia, formerly Pseudomonas cepacia [TaxId: 292]} Length = 131 Back     information, alignment and structure
>d1f1ua1 d.32.1.3 (A:2-147) Homoprotocatechuate 2,3-dioxygenase {Arthrobacter globiformis [TaxId: 1665]} Length = 146 Back     information, alignment and structure
>d1t47a1 d.32.1.3 (A:16-178) 4-hydroxyphenylpyruvate dioxygenase, HppD {Streptomyces avermitilis [TaxId: 33903]} Length = 163 Back     information, alignment and structure
>d1sp8a1 d.32.1.3 (A:36-207) 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Zea mays) [TaxId: 4577]} Length = 172 Back     information, alignment and structure
>d1kw3b2 d.32.1.3 (B:133-288) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Pseudomonas sp. [TaxId: 306]} Length = 156 Back     information, alignment and structure
>d1kw3b1 d.32.1.3 (B:1-132) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Pseudomonas sp. [TaxId: 306]} Length = 132 Back     information, alignment and structure
>d2pjsa1 d.32.1.2 (A:3-113) Uncharacterized protein Atu1953 {Agrobacterium tumefaciens [TaxId: 358]} Length = 111 Back     information, alignment and structure
>d1jifa_ d.32.1.2 (A:) Bleomycin resistance protein, BRP {Streptomyces verticillus [TaxId: 29309]} Length = 122 Back     information, alignment and structure
>d1ecsa_ d.32.1.2 (A:) Bleomycin resistance protein, BRP {Klebsiella pneumoniae [TaxId: 573]} Length = 120 Back     information, alignment and structure
>d1sqda1 d.32.1.3 (A:14-180) 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 167 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query138
d2i7ra1115 Hypotheical protein SP0731 {Streptococcus pneumoni 99.94
d1r9ca_130 Fosfomycin resistance protein FosX {Mesorhizobium 99.93
d1zswa2170 Hypothetical protein BC1024 {Bacillus cereus [TaxI 99.93
d1npba_140 Fosfomycin resistance protein A (FosA) {Serratia m 99.92
d1ss4a_149 Hypothetical protein BC1747 {Bacillus cereus (stra 99.92
d1nkia_134 Fosfomycin resistance protein A (FosA) {Pseudomona 99.92
d1zswa1144 Hypothetical protein BC1024 {Bacillus cereus [TaxI 99.92
d1xqaa_113 Hypothetical protein BC3580 {Bacillus cereus [TaxI 99.92
d1lgta1131 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzy 99.91
d1mpya2162 Catechol 2,3-dioxygenase (metapyrocatechase) {Pseu 99.91
d1f9za_135 Glyoxalase I (lactoylglutathione lyase) {Escherich 99.91
d1jc4a_145 Methylmalonyl-CoA epimerase {Propionibacterium she 99.9
d1kw3b1132 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzy 99.9
d1klla_128 Mitomycin resistance protein D, MRD {Streptomyces 99.89
d1f1ua1146 Homoprotocatechuate 2,3-dioxygenase {Arthrobacter 99.89
d1qipa_176 Glyoxalase I (lactoylglutathione lyase) {Human (Ho 99.89
d1twua_137 Hypothetical protein YycE {Bacillus subtilis [TaxI 99.89
d2pjsa1111 Uncharacterized protein Atu1953 {Agrobacterium tum 99.89
d2c21a1139 Glyoxalase I (lactoylglutathione lyase) {Leishmani 99.88
d1ecsa_120 Bleomycin resistance protein, BRP {Klebsiella pneu 99.85
d1f1ua2176 Homoprotocatechuate 2,3-dioxygenase {Arthrobacter 99.85
d1mpya1145 Catechol 2,3-dioxygenase (metapyrocatechase) {Pseu 99.85
d1t47a1163 4-hydroxyphenylpyruvate dioxygenase, HppD {Strepto 99.85
d1sqia1149 4-hydroxyphenylpyruvate dioxygenase, HppD {Human ( 99.84
d1kw3b2156 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzy 99.84
d1jifa_122 Bleomycin resistance protein, BRP {Streptomyces ve 99.84
d1sqda1167 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-e 99.82
d1sp8a1172 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Z 99.8
d1xy7a_135 Hypothetical protein At5g48480 {Thale cress (Arabi 99.78
d1xrka_120 Bleomycin resistance protein, BRP {Streptoalloteic 99.78
d1cjxa1150 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudom 99.68
d1sp8a2224 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Z 99.52
d1u6la_137 Hypothetical protein PA1353 {Pseudomonas aeruginos 99.46
d1cjxa2203 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudom 99.45
d1sqia2210 4-hydroxyphenylpyruvate dioxygenase, HppD {Human ( 99.43
d1t47a2199 4-hydroxyphenylpyruvate dioxygenase, HppD {Strepto 99.35
d1sqda2230 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-e 99.32
d1u7ia_134 Hypothetical protein PA1358 {Pseudomonas aeruginos 99.27
d1tsja_129 Hypothetical protein MW1090 {Staphylococcus aureus 98.97
d1u69a_156 Hypothetical protein PA2721 {Pseudomonas aeruginos 98.13
d1sqda1167 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-e 96.94
d1sp8a1172 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Z 96.78
d1xqaa_113 Hypothetical protein BC3580 {Bacillus cereus [TaxI 96.08
d1ss4a_149 Hypothetical protein BC1747 {Bacillus cereus (stra 95.82
d1jc4a_145 Methylmalonyl-CoA epimerase {Propionibacterium she 95.54
d1cjxa1150 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudom 95.17
d1sqia1149 4-hydroxyphenylpyruvate dioxygenase, HppD {Human ( 94.38
d1t47a1163 4-hydroxyphenylpyruvate dioxygenase, HppD {Strepto 93.76
d1klla_128 Mitomycin resistance protein D, MRD {Streptomyces 93.64
d2g3aa1137 Probable acetyltransferase Atu2258 {Agrobacterium 93.18
d1lgta1131 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzy 92.63
d1zswa2 170 Hypothetical protein BC1024 {Bacillus cereus [TaxI 91.6
d1zswa1144 Hypothetical protein BC1024 {Bacillus cereus [TaxI 90.9
d1cjxa2203 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudom 90.63
d1qipa_176 Glyoxalase I (lactoylglutathione lyase) {Human (Ho 90.45
d1kw3b1132 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzy 89.86
d1y9wa1140 Probable acetyltransferase BC2806 {Bacillus cereus 89.78
d1f1ua2 176 Homoprotocatechuate 2,3-dioxygenase {Arthrobacter 89.47
d1t47a2199 4-hydroxyphenylpyruvate dioxygenase, HppD {Strepto 88.69
d1sp8a2224 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Z 88.44
d1mpya1145 Catechol 2,3-dioxygenase (metapyrocatechase) {Pseu 88.26
d1r9ca_130 Fosfomycin resistance protein FosX {Mesorhizobium 87.91
d1sqia2210 4-hydroxyphenylpyruvate dioxygenase, HppD {Human ( 87.63
d1sqda2230 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-e 87.47
d1f1ua1146 Homoprotocatechuate 2,3-dioxygenase {Arthrobacter 87.29
d2i7ra1115 Hypotheical protein SP0731 {Streptococcus pneumoni 86.97
d2f06a171 Hypothetical protein BT0572 {Bacteroides thetaiota 86.44
d1kw3b2156 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzy 86.34
d1k4na_190 Hypothetical protein YecM (EC4020) {Escherichia co 84.94
d1mpya2 162 Catechol 2,3-dioxygenase (metapyrocatechase) {Pseu 83.98
d1nkia_134 Fosfomycin resistance protein A (FosA) {Pseudomona 83.93
d1npba_140 Fosfomycin resistance protein A (FosA) {Serratia m 82.5
>d2i7ra1 d.32.1.2 (A:1-115) Hypotheical protein SP0731 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase
superfamily: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase
family: Antibiotic resistance proteins
domain: Hypotheical protein SP0731
species: Streptococcus pneumoniae [TaxId: 1313]
Probab=99.94  E-value=6.4e-26  Score=133.29  Aligned_cols=111  Identities=16%  Similarity=0.189  Sum_probs=89.6

Q ss_pred             eeeeeEEEEeCCHHHHHHHHHHhhCCeeeccCCCCCCCeeEEEEEeCCeEEEEeecCCCCCCCCCCCCCCCCceEEEEEC
Q 032565           16 VSVHHVGILCENLERSLEFYQNILGLEINEARPHDKLPYRGAWLWVGAEMIHLMELPNPDPLSGRPEHGGRDRHTCIAIR   95 (138)
Q Consensus        16 ~~l~hi~l~v~d~~~a~~fy~~~lg~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~hi~~~v~   95 (138)
                      |+|+|+.|.|+|+++|.+||+++||+++....+      ..+++..|+..+.+........    .. .+...+++|.|+
T Consensus         1 m~l~~i~i~V~di~~a~~FYe~~lg~~~~~~~~------~~~~~~~g~~~l~l~~~~~~~~----~~-~~~~~~~~f~v~   69 (115)
T d2i7ra1           1 MNLNQLDIIVSNVPQVCADLEHILDKKADYAND------GFAQFTIGSHCLMLSQNHLVPL----EN-FQSGIIIHIEVE   69 (115)
T ss_dssp             CEEEEEEEECSCHHHHHHHHHHHHTSCCSEEET------TEEEEEETTEEEEEESSCSSSC----CC-CCSCEEEEEECS
T ss_pred             CcceEEEEEECCHHHHHHHHHHhhCCceeeecC------CeEEEEEcCceeeeeecccCCC----CC-CCcceEEEEEEC
Confidence            469999999999999999999999999876543      3467888988888875432211    11 233468999999


Q ss_pred             CHHHHHHHHHHCCCeEEec----CCCccEEEEECCCCCeEEEEeec
Q 032565           96 DVSKLKMILDKAGISYTLS----KSGRPAIFTRDPDANALEFTQVD  137 (138)
Q Consensus        96 d~~~~~~~l~~~g~~~~~~----~~~~~~~~~~DPdG~~~e~~~~~  137 (138)
                      |+++++++|+++|+++..+    ++|.+.++|+|||||.|||.+.+
T Consensus        70 D~d~~~~~l~~~G~~i~~~~~~~~~g~~~~~~~DPdGn~ie~~~~k  115 (115)
T d2i7ra1          70 DVDQNYKRLNELGIKVLHGPTVTDWGTESLLVQGPAGLVLDFYRMK  115 (115)
T ss_dssp             CHHHHHHHHHHHTCCEEEEEEECTTSCEEEEEECGGGCEEEEEECC
T ss_pred             CHHHHHHHHHhhccccccceEEeeCCeEEEEEECCCCCEEEEEEeC
Confidence            9999999999999987643    66888999999999999999864



>d1r9ca_ d.32.1.2 (A:) Fosfomycin resistance protein FosX {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1zswa2 d.32.1.10 (A:145-314) Hypothetical protein BC1024 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1npba_ d.32.1.2 (A:) Fosfomycin resistance protein A (FosA) {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1ss4a_ d.32.1.6 (A:) Hypothetical protein BC1747 {Bacillus cereus (strain ATCC 14579 / DSM 31) [TaxId: 226900]} Back     information, alignment and structure
>d1nkia_ d.32.1.2 (A:) Fosfomycin resistance protein A (FosA) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1zswa1 d.32.1.10 (A:1-144) Hypothetical protein BC1024 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1xqaa_ d.32.1.2 (A:) Hypothetical protein BC3580 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1lgta1 d.32.1.3 (A:2-132) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Burkholderia cepacia, formerly Pseudomonas cepacia [TaxId: 292]} Back     information, alignment and structure
>d1mpya2 d.32.1.3 (A:146-307) Catechol 2,3-dioxygenase (metapyrocatechase) {Pseudomonas putida, mt2 [TaxId: 303]} Back     information, alignment and structure
>d1f9za_ d.32.1.1 (A:) Glyoxalase I (lactoylglutathione lyase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jc4a_ d.32.1.4 (A:) Methylmalonyl-CoA epimerase {Propionibacterium shermanii [TaxId: 1752]} Back     information, alignment and structure
>d1kw3b1 d.32.1.3 (B:1-132) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1klla_ d.32.1.2 (A:) Mitomycin resistance protein D, MRD {Streptomyces lavendulae [TaxId: 1914]} Back     information, alignment and structure
>d1f1ua1 d.32.1.3 (A:2-147) Homoprotocatechuate 2,3-dioxygenase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1qipa_ d.32.1.1 (A:) Glyoxalase I (lactoylglutathione lyase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1twua_ d.32.1.8 (A:) Hypothetical protein YycE {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2pjsa1 d.32.1.2 (A:3-113) Uncharacterized protein Atu1953 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2c21a1 d.32.1.1 (A:3-141) Glyoxalase I (lactoylglutathione lyase) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1ecsa_ d.32.1.2 (A:) Bleomycin resistance protein, BRP {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1f1ua2 d.32.1.3 (A:148-323) Homoprotocatechuate 2,3-dioxygenase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1mpya1 d.32.1.3 (A:1-145) Catechol 2,3-dioxygenase (metapyrocatechase) {Pseudomonas putida, mt2 [TaxId: 303]} Back     information, alignment and structure
>d1t47a1 d.32.1.3 (A:16-178) 4-hydroxyphenylpyruvate dioxygenase, HppD {Streptomyces avermitilis [TaxId: 33903]} Back     information, alignment and structure
>d1sqia1 d.32.1.3 (A:8-156) 4-hydroxyphenylpyruvate dioxygenase, HppD {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kw3b2 d.32.1.3 (B:133-288) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1jifa_ d.32.1.2 (A:) Bleomycin resistance protein, BRP {Streptomyces verticillus [TaxId: 29309]} Back     information, alignment and structure
>d1sqda1 d.32.1.3 (A:14-180) 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1sp8a1 d.32.1.3 (A:36-207) 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1xy7a_ d.32.1.9 (A:) Hypothetical protein At5g48480 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1xrka_ d.32.1.2 (A:) Bleomycin resistance protein, BRP {Streptoalloteichus hindustanus [TaxId: 2017]} Back     information, alignment and structure
>d1cjxa1 d.32.1.3 (A:4-153) 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1sp8a2 d.32.1.3 (A:208-431) 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1u6la_ d.32.1.7 (A:) Hypothetical protein PA1353 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1cjxa2 d.32.1.3 (A:154-356) 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1sqia2 d.32.1.3 (A:157-366) 4-hydroxyphenylpyruvate dioxygenase, HppD {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t47a2 d.32.1.3 (A:179-377) 4-hydroxyphenylpyruvate dioxygenase, HppD {Streptomyces avermitilis [TaxId: 33903]} Back     information, alignment and structure
>d1sqda2 d.32.1.3 (A:181-410) 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1u7ia_ d.32.1.7 (A:) Hypothetical protein PA1358 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1tsja_ d.32.1.7 (A:) Hypothetical protein MW1090 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1u69a_ d.32.1.7 (A:) Hypothetical protein PA2721 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1sqda1 d.32.1.3 (A:14-180) 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1sp8a1 d.32.1.3 (A:36-207) 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1xqaa_ d.32.1.2 (A:) Hypothetical protein BC3580 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1ss4a_ d.32.1.6 (A:) Hypothetical protein BC1747 {Bacillus cereus (strain ATCC 14579 / DSM 31) [TaxId: 226900]} Back     information, alignment and structure
>d1jc4a_ d.32.1.4 (A:) Methylmalonyl-CoA epimerase {Propionibacterium shermanii [TaxId: 1752]} Back     information, alignment and structure
>d1cjxa1 d.32.1.3 (A:4-153) 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1sqia1 d.32.1.3 (A:8-156) 4-hydroxyphenylpyruvate dioxygenase, HppD {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t47a1 d.32.1.3 (A:16-178) 4-hydroxyphenylpyruvate dioxygenase, HppD {Streptomyces avermitilis [TaxId: 33903]} Back     information, alignment and structure
>d1klla_ d.32.1.2 (A:) Mitomycin resistance protein D, MRD {Streptomyces lavendulae [TaxId: 1914]} Back     information, alignment and structure
>d2g3aa1 d.108.1.1 (A:1-137) Probable acetyltransferase Atu2258 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1lgta1 d.32.1.3 (A:2-132) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Burkholderia cepacia, formerly Pseudomonas cepacia [TaxId: 292]} Back     information, alignment and structure
>d1zswa2 d.32.1.10 (A:145-314) Hypothetical protein BC1024 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1zswa1 d.32.1.10 (A:1-144) Hypothetical protein BC1024 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1cjxa2 d.32.1.3 (A:154-356) 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1qipa_ d.32.1.1 (A:) Glyoxalase I (lactoylglutathione lyase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kw3b1 d.32.1.3 (B:1-132) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1y9wa1 d.108.1.1 (A:1-140) Probable acetyltransferase BC2806 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1f1ua2 d.32.1.3 (A:148-323) Homoprotocatechuate 2,3-dioxygenase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1t47a2 d.32.1.3 (A:179-377) 4-hydroxyphenylpyruvate dioxygenase, HppD {Streptomyces avermitilis [TaxId: 33903]} Back     information, alignment and structure
>d1sp8a2 d.32.1.3 (A:208-431) 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1mpya1 d.32.1.3 (A:1-145) Catechol 2,3-dioxygenase (metapyrocatechase) {Pseudomonas putida, mt2 [TaxId: 303]} Back     information, alignment and structure
>d1r9ca_ d.32.1.2 (A:) Fosfomycin resistance protein FosX {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1sqia2 d.32.1.3 (A:157-366) 4-hydroxyphenylpyruvate dioxygenase, HppD {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sqda2 d.32.1.3 (A:181-410) 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1f1ua1 d.32.1.3 (A:2-147) Homoprotocatechuate 2,3-dioxygenase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d2i7ra1 d.32.1.2 (A:1-115) Hypotheical protein SP0731 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2f06a1 d.58.18.11 (A:71-141) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1kw3b2 d.32.1.3 (B:133-288) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1k4na_ d.32.1.5 (A:) Hypothetical protein YecM (EC4020) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mpya2 d.32.1.3 (A:146-307) Catechol 2,3-dioxygenase (metapyrocatechase) {Pseudomonas putida, mt2 [TaxId: 303]} Back     information, alignment and structure
>d1nkia_ d.32.1.2 (A:) Fosfomycin resistance protein A (FosA) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1npba_ d.32.1.2 (A:) Fosfomycin resistance protein A (FosA) {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure