Citrus Sinensis ID: 032577

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------
MEEGFRFFKLNAGAKIPSLGLGTWAAAPDVVGDAIAAAVKVGYRHIDCAQIYGNEKGIGSALKKLFDDGVVKREDLWITSKLWCNNHLPEDVPKALDRTLQDLQLDYVDLYLVCLYDTIQHLFIFHLLIEVSLRNCF
ccccccEEEccccccccccccccccccccHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHccccccccEEEEccccccccccccHHHHHHHHHHHHccccHHHHHHHccccccccccccccccccccccc
ccccccEEEcccccEEEcEcEEcccccHHHHHHHHHHHHHHcccEEEccHHHccHHHHHHHHHHHHHcccccHHHcEEEEEEcHHHccHHHHHHHHHHHHHHHccccEEEEEEEccccccccHHHHHHHHHHHHHcc
MEEGFRFfklnagakipslglgtwaaapdVVGDAIAAAVKVGYRHIDCAQIYGNEKGIGSALKKLfddgvvkredLWITSKLwcnnhlpedvpkALDRTLQDLQLDYVDLYLVCLYDTIQHLFIFHLLIEVSLRNCF
MEEGFRFFKLNAGAKIPSLGLGTWAAAPDVVGDAIAAAVKVGYRHIDCAQIYGNEKGIGSALKKLFDDGVVKREDLWITSKLWCNNHLPEDVPKALDRTLQDLQLDYVDLYLVCLYDTIQHLFIFHLLIEVSLRNCF
MEEGFRFFKLNAGAKIPSLGLGTWAAAPDVVGDAIAAAVKVGYRHIDCAQIYGNEKGIGSALKKLFDDGVVKREDLWITSKLWCNNHLPEDVPKALDRTlqdlqldyvdlylvclydTIQHLFIFHLLIEVSLRNCF
****FRFFKLNAGAKIPSLGLGTWAAAPDVVGDAIAAAVKVGYRHIDCAQIYGNEKGIGSALKKLFDDGVVKREDLWITSKLWCNNHLPEDVPKALDRTLQDLQLDYVDLYLVCLYDTIQHLFIFHLLIEVSLR***
****FRF*KLNAGAKIPSLGLGTWAAAPDVVGDAIAAAVKVGYRHIDCAQIYGNEKGIGSALKKLFDDGVVKREDLWITSKLWCNNHLPEDVPKALDRTLQDLQLDYVDLYLVCLYDTIQHLFIFHLLIEVSL*NCF
MEEGFRFFKLNAGAKIPSLGLGTWAAAPDVVGDAIAAAVKVGYRHIDCAQIYGNEKGIGSALKKLFDDGVVKREDLWITSKLWCNNHLPEDVPKALDRTLQDLQLDYVDLYLVCLYDTIQHLFIFHLLIEVSLRNCF
***GFRFFKLNAGAKIPSLGLGTWAAAPDVVGDAIAAAVKVGYRHIDCAQIYGNEKGIGSALKKLFDDGVVKREDLWITSKLWCNNHLPEDVPKALDRTLQDLQLDYVDLYLVCLYDTIQHLFIFHLLIEVSLRNCF
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEEGFRFFKLNAGAKIPSLGLGTWAAAPDVVGDAIAAAVKVGYRHIDCAQIYGNEKGIGSALKKLFDDGVVKREDLWITSKLWCNNHLPEDVPKALDRTLQDLQLDYVDLYLVCLYDTIQHLFIFHLLIEVSLRNCF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query137 2.2.26 [Sep-21-2011]
Q0PGJ6 315 Aldo-keto reductase famil no no 0.824 0.358 0.743 5e-46
Q84TF0 314 Aldo-keto reductase famil no no 0.824 0.359 0.743 3e-45
O80944 311 Aldo-keto reductase famil no no 0.795 0.350 0.681 1e-39
Q9M338 315 Aldo-keto reductase famil no no 0.824 0.358 0.716 1e-34
Q10494 321 Uncharacterized oxidoredu yes no 0.744 0.317 0.547 5e-30
O42888 325 Uncharacterized oxidoredu no no 0.751 0.316 0.542 2e-28
Q3ZCJ2 325 Alcohol dehydrogenase [NA yes no 0.759 0.32 0.580 2e-27
Q9JII6 325 Alcohol dehydrogenase [NA yes no 0.759 0.32 0.561 3e-27
Q8SSK6 301 Aldose reductase OS=Encep yes no 0.744 0.338 0.607 3e-27
Q5R5D5 325 Alcohol dehydrogenase [NA yes no 0.759 0.32 0.571 3e-27
>sp|Q0PGJ6|AKRC9_ARATH Aldo-keto reductase family 4 member C9 OS=Arabidopsis thaliana GN=AKR4C9 PE=1 SV=1 Back     alignment and function desciption
 Score =  182 bits (463), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 99/113 (87%)

Query: 1   MEEGFRFFKLNAGAKIPSLGLGTWAAAPDVVGDAIAAAVKVGYRHIDCAQIYGNEKGIGS 60
           M     FFKLN GAK PS+GLGTW A+P +VGDA+AAAVK+GYRHIDCAQIYGNEK IG+
Sbjct: 1   MANAITFFKLNTGAKFPSVGLGTWQASPGLVGDAVAAAVKIGYRHIDCAQIYGNEKEIGA 60

Query: 61  ALKKLFDDGVVKREDLWITSKLWCNNHLPEDVPKALDRTLQDLQLDYVDLYLV 113
            LKKLF+D VVKREDL+ITSKLWC +H P+DVP+AL+RTL+DLQL+YVDLYL+
Sbjct: 61  VLKKLFEDRVVKREDLFITSKLWCTDHDPQDVPEALNRTLKDLQLEYVDLYLI 113
Oxidoreductase acting on a broad range of substrates: reduces ketosteroids, aromatic aldehydes, ketones, sugars and other aliphatic aldehydes, and oxidizes hydroxysteroids. May function as detoxifiying enzyme by reducing a range of toxic aldehydes and ketones produced during stress.
Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 1EC: .EC: 1EC: .EC: -
>sp|Q84TF0|AKRCA_ARATH Aldo-keto reductase family 4 member C10 OS=Arabidopsis thaliana GN=AKR4C10 PE=1 SV=1 Back     alignment and function description
>sp|O80944|AKRC8_ARATH Aldo-keto reductase family 4 member C8 OS=Arabidopsis thaliana GN=AKR4C8 PE=1 SV=2 Back     alignment and function description
>sp|Q9M338|AKRCB_ARATH Aldo-keto reductase family 4 member C11 OS=Arabidopsis thaliana GN=AKR4C11 PE=2 SV=1 Back     alignment and function description
>sp|Q10494|YDG7_SCHPO Uncharacterized oxidoreductase C26F1.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC26F1.07 PE=3 SV=1 Back     alignment and function description
>sp|O42888|YBN4_SCHPO Uncharacterized oxidoreductase C8E4.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC8E4.04 PE=3 SV=1 Back     alignment and function description
>sp|Q3ZCJ2|AK1A1_BOVIN Alcohol dehydrogenase [NADP(+)] OS=Bos taurus GN=AKR1A1 PE=2 SV=1 Back     alignment and function description
>sp|Q9JII6|AK1A1_MOUSE Alcohol dehydrogenase [NADP(+)] OS=Mus musculus GN=Akr1a1 PE=1 SV=3 Back     alignment and function description
>sp|Q8SSK6|ALDR_ENCCU Aldose reductase OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU01_0970 PE=1 SV=1 Back     alignment and function description
>sp|Q5R5D5|AK1A1_PONAB Alcohol dehydrogenase [NADP(+)] OS=Pongo abelii GN=AKR1A1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query137
255578001 301 aldo-keto reductase, putative [Ricinus c 0.824 0.375 0.743 3e-46
312281947 315 unnamed protein product [Thellungiella h 0.824 0.358 0.761 1e-45
388520373 315 unknown [Lotus japonicus] 0.824 0.358 0.769 2e-45
225440480 315 PREDICTED: aldo-keto reductase family 4 0.824 0.358 0.743 2e-45
363808266 312 uncharacterized protein LOC100788951 [Gl 0.824 0.362 0.761 1e-44
42569711 283 NAD(P)-linked oxidoreductase-like protei 0.824 0.399 0.743 2e-44
3236259 290 putative alcohol dehydrogenase [Arabidop 0.824 0.389 0.743 3e-44
297790118 350 hypothetical protein ARALYDRAFT_333154 [ 0.824 0.322 0.752 3e-44
79324628 315 NAD(P)-linked oxidoreductase-like protei 0.824 0.358 0.743 3e-44
255311879 335 Chain A, Crystal Structure Of The Plant 0.824 0.337 0.743 3e-44
>gi|255578001|ref|XP_002529872.1| aldo-keto reductase, putative [Ricinus communis] gi|223530648|gb|EEF32522.1| aldo-keto reductase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  189 bits (480), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 98/113 (86%)

Query: 1   MEEGFRFFKLNAGAKIPSLGLGTWAAAPDVVGDAIAAAVKVGYRHIDCAQIYGNEKGIGS 60
           M +  RFF+LN GAKIPS+GLGTW A P VVG A++ A+K GYRHIDCA +YGNEK IGS
Sbjct: 1   MAKAIRFFELNTGAKIPSVGLGTWQAEPGVVGQAVSTAIKAGYRHIDCASVYGNEKEIGS 60

Query: 61  ALKKLFDDGVVKREDLWITSKLWCNNHLPEDVPKALDRTLQDLQLDYVDLYLV 113
           +LKKLF DGVVKREDLW+TSKLWC +H PEDVP+ALDRTL++LQLDYVDLYL+
Sbjct: 61  SLKKLFADGVVKREDLWVTSKLWCTDHAPEDVPQALDRTLRELQLDYVDLYLI 113

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|312281947|dbj|BAJ33839.1| unnamed protein product [Thellungiella halophila] Back     alignment and taxonomy information
>gi|388520373|gb|AFK48248.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|225440480|ref|XP_002273035.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|363808266|ref|NP_001242750.1| uncharacterized protein LOC100788951 [Glycine max] gi|255634877|gb|ACU17797.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|42569711|ref|NP_181313.3| NAD(P)-linked oxidoreductase-like protein [Arabidopsis thaliana] gi|330254354|gb|AEC09448.1| NAD(P)-linked oxidoreductase-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|3236259|gb|AAC23647.1| putative alcohol dehydrogenase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297790118|ref|XP_002862967.1| hypothetical protein ARALYDRAFT_333154 [Arabidopsis lyrata subsp. lyrata] gi|297308755|gb|EFH39226.1| hypothetical protein ARALYDRAFT_333154 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|79324628|ref|NP_001031505.1| NAD(P)-linked oxidoreductase-like protein [Arabidopsis thaliana] gi|122241485|sp|Q0PGJ6.1|AKRC9_ARATH RecName: Full=Aldo-keto reductase family 4 member C9 gi|111182165|gb|ABH07515.1| aldo-keto reductase [Arabidopsis thaliana] gi|330254355|gb|AEC09449.1| NAD(P)-linked oxidoreductase-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|255311879|pdb|3H7U|A Chain A, Crystal Structure Of The Plant Stress-Response Enzyme Akr4c9 Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query137
TAIR|locus:2040646 315 ChlAKR "Chloroplastic aldo-ket 0.722 0.314 0.737 3e-37
TAIR|locus:2065639 314 AKR4C10 "Aldo-keto reductase f 0.722 0.315 0.717 1.5e-35
TAIR|locus:2084505 315 AKR4C11 "Aldo-keto reductase f 0.722 0.314 0.686 7.7e-32
TAIR|locus:2040751 311 AKR4C8 "Aldo-keto reductase fa 0.693 0.305 0.656 1.8e-30
POMBASE|SPAC26F1.07 321 SPAC26F1.07 "glucose 1-dehydro 0.642 0.274 0.543 2.9e-23
ASPGD|ASPL0000008512 314 AN5986 [Emericella nidulans (t 0.642 0.280 0.522 1e-22
POMBASE|SPBC8E4.04 325 SPBC8E4.04 "alditol NADP+ 1-ox 0.649 0.273 0.537 7e-22
FB|FBgn0036183 322 CG6083 [Drosophila melanogaste 0.656 0.279 0.511 9e-22
MGI|MGI:1353494 316 Akr1b3 "aldo-keto reductase fa 0.664 0.287 0.516 1.5e-21
UNIPROTKB|F1NT57 324 AKR1B10 "Uncharacterized prote 0.678 0.287 0.494 1.9e-21
TAIR|locus:2040646 ChlAKR "Chloroplastic aldo-keto reductase" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 400 (145.9 bits), Expect = 3.0e-37, P = 3.0e-37
 Identities = 73/99 (73%), Positives = 85/99 (85%)

Query:     1 MEEGFRFFKLNAGAKIPSLGLGTWAAAPDVVGDAIAAAVKVGYRHIDCAQIYGNEKGIGS 60
             M     FFKLN GAK PS+GLGTW A+P +VGDA+AAAVK+GYRHIDCAQIYGNEK IG+
Sbjct:     1 MANAITFFKLNTGAKFPSVGLGTWQASPGLVGDAVAAAVKIGYRHIDCAQIYGNEKEIGA 60

Query:    61 ALKKLFDDGVVKREDLWITSKLWCNNHLPEDVPKALDRT 99
              LKKLF+D VVKREDL+ITSKLWC +H P+DVP+AL+RT
Sbjct:    61 VLKKLFEDRVVKREDLFITSKLWCTDHDPQDVPEALNRT 99
GO:0005737 "cytoplasm" evidence=ISM
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA;IDA
GO:0004033 "aldo-keto reductase (NADP) activity" evidence=IDA
GO:0009409 "response to cold" evidence=IEP
GO:0009414 "response to water deprivation" evidence=IEP
GO:0009651 "response to salt stress" evidence=IEP
GO:0016229 "steroid dehydrogenase activity" evidence=IDA
GO:0070401 "NADP+ binding" evidence=IDA
GO:0008106 "alcohol dehydrogenase (NADP+) activity" evidence=IDA
GO:0009507 "chloroplast" evidence=IDA
TAIR|locus:2065639 AKR4C10 "Aldo-keto reductase family 4 member C10" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2084505 AKR4C11 "Aldo-keto reductase family 4 member C11" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2040751 AKR4C8 "Aldo-keto reductase family 4 member C8" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
POMBASE|SPAC26F1.07 SPAC26F1.07 "glucose 1-dehydrogenase (NADP+) (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
ASPGD|ASPL0000008512 AN5986 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
POMBASE|SPBC8E4.04 SPBC8E4.04 "alditol NADP+ 1-oxidoreductase activity (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
FB|FBgn0036183 CG6083 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
MGI|MGI:1353494 Akr1b3 "aldo-keto reductase family 1, member B3 (aldose reductase)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1NT57 AKR1B10 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.1.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00021382001
SubName- Full=Chromosome chr8 scaffold_23, whole genome shotgun sequence; (290 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query137
COG0656 280 COG0656, ARA1, Aldo/keto reductases, related to di 9e-43
PRK11565 275 PRK11565, dkgA, 2,5-diketo-D-gluconate reductase A 8e-34
cd06660 285 cd06660, Aldo_ket_red, Aldo-keto reductases (AKRs) 9e-31
PRK11172 267 PRK11172, dkgB, 2,5-diketo-D-gluconate reductase B 6e-25
pfam00248 277 pfam00248, Aldo_ket_red, Aldo/keto reductase famil 1e-20
COG0667 316 COG0667, Tas, Predicted oxidoreductases (related t 9e-11
COG1453 391 COG1453, COG1453, Predicted oxidoreductases of the 2e-07
PLN02587 314 PLN02587, PLN02587, L-galactose dehydrogenase 8e-06
TIGR01293 317 TIGR01293, Kv_beta, voltage-dependent potassium ch 3e-05
COG4989 298 COG4989, COG4989, Predicted oxidoreductase [Genera 1e-04
PRK10625 346 PRK10625, tas, putative aldo-keto reductase; Provi 0.003
PRK09912 346 PRK09912, PRK09912, L-glyceraldehyde 3-phosphate r 0.003
>gnl|CDD|223729 COG0656, ARA1, Aldo/keto reductases, related to diketogulonate reductase [General function prediction only] Back     alignment and domain information 
 Score =  142 bits (359), Expect = 9e-43
 Identities = 49/108 (45%), Positives = 73/108 (67%), Gaps = 5/108 (4%)

Query: 7   FFKLNAGAKIPSLGLGTWAAAPDV-VGDAIAAAVKVGYRHIDCAQIYGNEKGIGSALKKL 65
              LN G +IP++GLGTW    D     A+ AA+++GYR ID A+IYGNE+ +G A+K  
Sbjct: 5   KVTLNNGVEIPAIGLGTWQIGDDEWAVRAVRAALELGYRLIDTAEIYGNEEEVGEAIK-- 62

Query: 66  FDDGVVKREDLWITSKLWCNNHLPEDVPKALDRTLQDLQLDYVDLYLV 113
             +  V RE+L+IT+K+W ++   ++  KAL+ +L+ L LDYVDLYL+
Sbjct: 63  --ESGVPREELFITTKVWPSDLGYDETLKALEASLKRLGLDYVDLYLI 108

Length = 280
>gnl|CDD|183203 PRK11565, dkgA, 2,5-diketo-D-gluconate reductase A; Provisional Back     alignment and domain information
>gnl|CDD|119408 cd06660, Aldo_ket_red, Aldo-keto reductases (AKRs) are a superfamily of soluble NAD(P)(H) oxidoreductases whose chief purpose is to reduce aldehydes and ketones to primary and secondary alcohols Back     alignment and domain information
>gnl|CDD|183012 PRK11172, dkgB, 2,5-diketo-D-gluconate reductase B; Provisional Back     alignment and domain information
>gnl|CDD|215817 pfam00248, Aldo_ket_red, Aldo/keto reductase family Back     alignment and domain information
>gnl|CDD|223739 COG0667, Tas, Predicted oxidoreductases (related to aryl-alcohol dehydrogenases) [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|224370 COG1453, COG1453, Predicted oxidoreductases of the aldo/keto reductase family [General function prediction only] Back     alignment and domain information
>gnl|CDD|178198 PLN02587, PLN02587, L-galactose dehydrogenase Back     alignment and domain information
>gnl|CDD|213602 TIGR01293, Kv_beta, voltage-dependent potassium channel beta subunit, animal Back     alignment and domain information
>gnl|CDD|227322 COG4989, COG4989, Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>gnl|CDD|236727 PRK10625, tas, putative aldo-keto reductase; Provisional Back     alignment and domain information
>gnl|CDD|182140 PRK09912, PRK09912, L-glyceraldehyde 3-phosphate reductase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 137
KOG1577 300 consensus Aldo/keto reductase family proteins [Gen 100.0
COG0656 280 ARA1 Aldo/keto reductases, related to diketogulona 100.0
COG0667 316 Tas Predicted oxidoreductases (related to aryl-alc 100.0
PRK11172 267 dkgB 2,5-diketo-D-gluconate reductase B; Provision 99.97
PRK11565 275 dkgA 2,5-diketo-D-gluconate reductase A; Provision 99.97
TIGR01293 317 Kv_beta voltage-dependent potassium channel beta s 99.97
PRK10625 346 tas putative aldo-keto reductase; Provisional 99.97
PRK09912 346 L-glyceraldehyde 3-phosphate reductase; Provisiona 99.97
PLN02587 314 L-galactose dehydrogenase 99.97
KOG1575 336 consensus Voltage-gated shaker-like K+ channel, su 99.96
cd06660 285 Aldo_ket_red Aldo-keto reductases (AKRs) are a sup 99.96
PRK10376 290 putative oxidoreductase; Provisional 99.95
PRK14863 292 bifunctional regulator KidO; Provisional 99.94
PF00248 283 Aldo_ket_red: Aldo/keto reductase family; InterPro 99.93
COG1453 391 Predicted oxidoreductases of the aldo/keto reducta 99.92
KOG1576 342 consensus Predicted oxidoreductase [Energy product 99.91
COG4989 298 Predicted oxidoreductase [General function predict 99.91
COG1748 389 LYS9 Saccharopine dehydrogenase and related protei 92.57
>KOG1577 consensus Aldo/keto reductase family proteins [General function prediction only] Back     alignment and domain information 
Probab=100.00  E-value=8.4e-38  Score=235.71  Aligned_cols=130  Identities=49%  Similarity=0.849  Sum_probs=120.4

Q ss_pred             CCCCCceeeCCCCCccccceeecccCChhHHHHHHHHHHHcCCCeeeCcccccCHHHHHHHHHhhhhCCCCCCCcEEEEe
Q 032577            1 MEEGFRFFKLNAGAKIPSLGLGTWAAAPDVVGDAIAAAVKVGYRHIDCAQIYGNEKGIGSALKKLFDDGVVKREDLWITS   80 (137)
Q Consensus         1 m~~~~~~~~l~~g~~v~~lglGt~~~~~~~~~~~l~~a~~~G~~~~Dta~~Yg~e~~~G~~l~~~~~~~~~~r~~~~i~t   80 (137)
                      |++.. +++|++|.+||.||||||+.+++++.++++.|+++||||||||..|+||+.+|++|++.++++.++|+++||+|
T Consensus         1 M~~~~-~~~Ln~G~~mP~iGlGTw~~~~~~~~~aV~~Al~~GYRHIDtA~~Y~NE~evG~aik~~i~~~~v~RediFiTS   79 (300)
T KOG1577|consen    1 MSSKT-TVKLNNGFKMPIIGLGTWQSPPGQVAEAVKAAIKAGYRHIDTAHVYGNEKEVGEAIKELLAEGGVKREDIFITS   79 (300)
T ss_pred             CCccc-eEeccCCCccceeeeEecccChhhHHHHHHHHHHhCcceeechhhhCChHHHHHHHHHHhhhCCcchhhheeee
Confidence            66655 88999999999999999998889999999999999999999999999999999999999988889999999999


Q ss_pred             ccCCCCCCchhHHHHHHHHHHHcCCCceeEEEEeecCCCCc-----------------hHHHHHHHHH
Q 032577           81 KLWCNNHLPEDVPKALDRTLQDLQLDYVDLYLVCLYDTIQH-----------------LFIFHLLIEV  131 (137)
Q Consensus        81 K~~~~~~~~~~i~~~~~~sL~~L~~~~lDl~~lH~p~~~~~-----------------~~~~~~l~~~  131 (137)
                      |+|+..+.++.++.++++||++||+||||||++|||...++                 .++|++|+++
T Consensus        80 Klw~~~~~~~~v~~al~~sLk~L~ldYvDLyLiH~P~~~k~~~~~~~~~~~~~~~~~~~~tW~amE~~  147 (300)
T KOG1577|consen   80 KLWPTDHAPELVEKALEKSLKKLQLDYVDLYLIHWPVAFKDSFPKDENGKVNYDDVDRIETWKAMEKL  147 (300)
T ss_pred             ccCccccChhhHHHHHHHHHHHhChhhhheeeEecccccCCCCCcccccccccccchHHHHHHHHHHH
Confidence            99999999999999999999999999999999999987621                 2578888875

>COG0656 ARA1 Aldo/keto reductases, related to diketogulonate reductase [General function prediction only] Back     alignment and domain information
>COG0667 Tas Predicted oxidoreductases (related to aryl-alcohol dehydrogenases) [Energy production and conversion] Back     alignment and domain information
>PRK11172 dkgB 2,5-diketo-D-gluconate reductase B; Provisional Back     alignment and domain information
>PRK11565 dkgA 2,5-diketo-D-gluconate reductase A; Provisional Back     alignment and domain information
>TIGR01293 Kv_beta voltage-dependent potassium channel beta subunit, animal Back     alignment and domain information
>PRK10625 tas putative aldo-keto reductase; Provisional Back     alignment and domain information
>PRK09912 L-glyceraldehyde 3-phosphate reductase; Provisional Back     alignment and domain information
>PLN02587 L-galactose dehydrogenase Back     alignment and domain information
>KOG1575 consensus Voltage-gated shaker-like K+ channel, subunit beta/KCNAB [Energy production and conversion] Back     alignment and domain information
>cd06660 Aldo_ket_red Aldo-keto reductases (AKRs) are a superfamily of soluble NAD(P)(H) oxidoreductases whose chief purpose is to reduce aldehydes and ketones to primary and secondary alcohols Back     alignment and domain information
>PRK10376 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK14863 bifunctional regulator KidO; Provisional Back     alignment and domain information
>PF00248 Aldo_ket_red: Aldo/keto reductase family; InterPro: IPR023210 The aldo-keto reductase family includes a number of related monomeric NADPH-dependent oxidoreductases, such as aldehyde reductase, aldose reductase, prostaglandin F synthase, xylose reductase, rho crystallin, and many others [] Back     alignment and domain information
>COG1453 Predicted oxidoreductases of the aldo/keto reductase family [General function prediction only] Back     alignment and domain information
>KOG1576 consensus Predicted oxidoreductase [Energy production and conversion] Back     alignment and domain information
>COG4989 Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query137
3h7u_A 335 Crystal Structure Of The Plant Stress-Response Enzy 5e-40
3h7r_A 331 Crystal Structure Of The Plant Stress-Response Enzy 9e-33
2pd5_A 316 Human Aldose Reductase Mutant V47i Complexed With Z 6e-22
2ipw_A 315 Crystal Structure Of C298a W219y Aldose Reductase C 7e-22
4gac_A 324 High Resolution Structure Of Mouse Aldehyde Reducta 7e-22
3q67_A 316 Human Aldose Reductase C298s Mutant In Complex With 8e-22
2pdx_A 316 Human Aldose Reductase Double Mutant S302r-C303d Co 8e-22
2pdm_A 316 Human Aldose Reductase Mutant S302r Complexed With 8e-22
2alr_A 324 Aldehyde Reductase Length = 324 8e-22
1pwl_A 316 Crystal Structure Of Human Aldose Reductase Complex 8e-22
3lz5_A 316 Human Aldose Reductase Mutant T113v Complexed With 8e-22
2pdk_A 316 Human Aldose Reductase Mutant L301m Complexed With 8e-22
1el3_A 316 Human Aldose Reductase Complexed With Idd384 Inhibi 8e-22
2pdq_A 316 Human Aldose Reductase Mutant C303d Complexed With 8e-22
1abn_A 315 The Crystal Structure Of The Aldose Reductase Nadph 8e-22
3lqg_A 316 Human Aldose Reductase Mutant T113a Complexed With 8e-22
3cv7_A 325 Crystal Structure Of Porcine Aldehyde Reductase Ter 8e-22
3ld5_A 316 Human Aldose Reductase Mutant T113s Complexed With 9e-22
3lbo_A 316 Human Aldose Reductase Mutant T113c Complexed With 9e-22
2agt_A 319 Aldose Reductase Mutant Leu 300 Pro Complexed With 9e-22
2pdi_A 316 Human Aldose Reductase Mutant L300a Complexed With 9e-22
2is7_A 315 Crystal Structure Of Aldose Reductase Complexed Wit 9e-22
1z3n_A 319 Human Aldose Reductase In Complex With Nadp+ And Th 9e-22
2pdb_A 316 Human Aldose Reductase Mutant F121p Complexed With 9e-22
1ef3_A 315 Fidarestat Bound To Human Aldose Reductase Length = 9e-22
2r24_A 316 Human Aldose Reductase Structure Length = 316 9e-22
2pdf_A 316 Human Aldose Reductase Mutant L300p Complexed With 9e-22
1xgd_A 315 Apo R268a Human Aldose Reductase Length = 315 9e-22
3onb_A 315 Bond Breakage And Relocation Of A Covalently Bound 9e-22
3rx2_A 336 Crystal Structure Of Human Aldose Reductase Complex 1e-21
1ae4_A 325 Aldehyde Reductase Complexed With Cofactor And Inhi 2e-21
1cwn_A 324 Crystal Structure Of Porcine Aldehyde Reductase Hol 2e-21
1hqt_A 326 The Crystal Structure Of An Aldehyde Reductase Y50f 3e-21
2acu_A 315 Tyrosine-48 Is The Proton Donor And Histidine-110 D 3e-21
3krb_A 334 Structure Of Aldose Reductase From Giardia Lamblia 8e-21
1ah0_A 316 Pig Aldose Reductase Complexed With Sorbinil Length 8e-21
1dla_A 314 Novel Nadph-Binding Domain Revealed By The Crystal 9e-21
1eko_A 315 Pig Aldose Reductase Complexed With Idd384 Inhibito 9e-21
3c3u_A 323 Crystal Structure Of Akr1c1 In Complex With Nadp An 1e-20
3gug_A 323 Crystal Structure Of Akr1c1 L308v Mutant In Complex 1e-20
1ye4_A 322 Crystal Structure Of The Lys-274 To Arg Mutant Of C 4e-20
1sm9_A 322 Crystal Structure Of An Engineered K274rn276d Doubl 4e-20
1jez_A 322 The Structure Of Xylose Reductase, A Dimeric Aldo-K 4e-20
1r38_A 322 Crystal Structure Of H114a Mutant Of Candida Tenuis 5e-20
1z9a_A 321 Crystal Structure Of The Asn-309 To Asp Mutant Of C 5e-20
1mrq_A 323 Crystal Structure Of Human 20alpha-hsd In Ternary C 5e-20
1qwk_A 317 Structural Genomics Of Caenorhabditis Elegans: Hypo 6e-20
3qkz_A 316 Crystal Structure Of Mutant His269arg Akr1b14 Lengt 5e-19
3o3r_A 316 Crystal Structure Of Akr1b14 In Complex With Nadp L 6e-19
1ihi_A 323 Crystal Structure Of Human Type Iii 3-Alpha-Hydroxy 6e-19
1frb_A 315 Fr-1 ProteinNADPHZOPOLRESTAT COMPLEX Length = 315 7e-19
1j96_A 323 Human 3alpha-Hsd Type 3 In Ternary Complex With Nad 3e-18
1xjb_A 325 Crystal Structure Of Human Type 3 3alpha-Hydroxyste 3e-18
1c9w_A 315 Cho Reductase With Nadp+ Length = 315 7e-18
1vp5_A 298 Crystal Structure Of 2,5-diketo-d-gluconic Acid Red 1e-17
2ipj_A 321 Crystal Structure Of H3alpha-Hydroxysteroid Dehydro 1e-17
1zua_X 317 Crystal Structure Of Akr1b10 Complexed With Nadp+ A 1e-17
2bgq_A 344 Apo Aldose Reductase From Barley Length = 344 4e-17
1q13_A 323 Crystal Structure Of Rabbit 20alpha Hyroxysteroid D 7e-17
3bur_A 326 Crystal Structure Of Delta(4)-3-Ketosteroid 5-Beta- 8e-17
3uzw_A 346 Crystal Structure Of 5beta-Reductase (Akr1d1) E120h 9e-17
3cmf_A 346 Crystal Structure Of Human Liver 5beta-Reductase (A 9e-17
3uwe_A 331 Akr1c3 Complexed With 3-Phenoxybenzoic Acid Length 3e-16
3r43_A 331 Akr1c3 Complexed With Mefenamic Acid Length = 331 3e-16
1q5m_A 322 Binary Complex Of Rabbit 20alpha-Hydroxysteroid Deh 3e-16
1s1p_A 331 Crystal Structures Of Prostaglandin D2 11-Ketoreduc 5e-16
2fvl_A 324 Crystal Structure Of Human 3-alpha Hydroxysteroid/d 5e-16
1ry0_A 323 Structure Of Prostaglandin F Synthase With Prostagl 5e-16
3o0k_A 283 Crystal Structure Of AldoKETO REDUCTASE FROM BRUCEL 9e-16
1mzr_A 296 Structure Of Dkga From E.Coli At 2.13 A Resolution 6e-15
1ral_A 308 Three-Dimensional Structure Of Rat Liver 3alpha- Hy 8e-15
1afs_A 323 Recombinant Rat Liver 3-Alpha-Hydroxysteroid Dehydr 8e-15
1lwi_A 322 3-Alpha-HydroxysteroidDIHYDRODIOL DEHYDROGENASE FRO 9e-15
3ln3_A 324 Crystal Structure Of Putative Reductase (Np_038806. 1e-14
1zgd_A 312 Chalcone Reductase Complexed With Nadp+ At 1.7 Angs 3e-14
4fzi_A 290 Crystal Structure Of Prostaglandin F Synthase From 3e-13
1m9h_A 278 Corynebacterium 2,5-dkgr A And Phe 22 Replaced With 2e-12
2ipf_A 318 Crystal Structure Of 17alpha-Hydroxysteroid Dehydro 2e-12
3cv6_A 323 The Crystal Structure Of Mouse 17-Alpha Hydroxyster 2e-12
2he5_A 323 Crystal Structure Of 17alpha-Hydroxysteroid Dehydro 2e-12
2ipg_A 319 Crystal Structure Of 17alpha-Hydroxysteroid Dehydro 3e-12
3fjn_A 323 The Crystal Structure Of 17-Alpha Hydroxysteroid De 3e-12
3up8_A 298 Crystal Structure Of A Putative 2,5-Diketo-D-Glucon 3e-12
1hw6_A 278 Crystal Structure Of Apo-2,5-Diketo-D-Gluconate Red 3e-12
1a80_A 277 Native 2,5-Diketo-D-Gluconic Acid Reductase A From 3e-12
4f40_A 288 X-Ray Crystal Structure Of Apo Prostaglandin F Synt 9e-12
3b3d_A 314 B.Subtilis Ytbe Length = 314 7e-11
3f7j_A 276 B.Subtilis Yvgn Length = 276 3e-10
3d3f_A 275 Crystal Structure Of Yvgn And Cofactor Nadph From B 4e-10
1vbj_A 281 The Crystal Structure Of Prostaglandin F Synthase F 1e-09
2wzm_A 283 Crystal Structure Of A Mycobacterium Aldo-Keto Redu 1e-05
>pdb|3H7U|A Chain A, Crystal Structure Of The Plant Stress-Response Enzyme Akr4c9 Length = 335 Back     alignment and structure 
Iteration: 1

 Score =  159 bits (401), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 73/99 (73%), Positives = 85/99 (85%)
Query: 1   MEEGFRFFKLNAGAKIPSLGLGTWAAAPDVVGDAIAAAVKVGYRHIDCAQIYGNEKGIGS 60
           M     FFKLN GAK PS+GLGTW A+P +VGDA+AAAVK+GYRHIDCAQIYGNEK IG+
Sbjct: 21  MANAITFFKLNTGAKFPSVGLGTWQASPGLVGDAVAAAVKIGYRHIDCAQIYGNEKEIGA 80
Query: 61  ALKKLFDDGVVKREDLWITSKLWCNNHLPEDVPKALDRT 99
            LKKLF+D VVKREDL+ITSKLWC +H P+DVP+AL+RT
Sbjct: 81  VLKKLFEDRVVKREDLFITSKLWCTDHDPQDVPEALNRT 119
>pdb|3H7R|A Chain A, Crystal Structure Of The Plant Stress-Response Enzyme Akr4c8 Length = 331 Back     alignment and structure
>pdb|2PD5|A Chain A, Human Aldose Reductase Mutant V47i Complexed With Zopolrestat Length = 316 Back     alignment and structure
>pdb|2IPW|A Chain A, Crystal Structure Of C298a W219y Aldose Reductase Complexed With Dichlorophenylacetic Acid Length = 315 Back     alignment and structure
>pdb|4GAC|A Chain A, High Resolution Structure Of Mouse Aldehyde Reductase (akr1a4) In Its Apo-form Length = 324 Back     alignment and structure
>pdb|3Q67|A Chain A, Human Aldose Reductase C298s Mutant In Complex With Nadp+ In Space Group P212121 Length = 316 Back     alignment and structure
>pdb|2PDX|A Chain A, Human Aldose Reductase Double Mutant S302r-C303d Complexed With Zopolrestat. Length = 316 Back     alignment and structure
>pdb|2PDM|A Chain A, Human Aldose Reductase Mutant S302r Complexed With Zopolrestat. Length = 316 Back     alignment and structure
>pdb|2ALR|A Chain A, Aldehyde Reductase Length = 324 Back     alignment and structure
>pdb|1PWL|A Chain A, Crystal Structure Of Human Aldose Reductase Complexed With Nadp And Minalrestat Length = 316 Back     alignment and structure
>pdb|3LZ5|A Chain A, Human Aldose Reductase Mutant T113v Complexed With Idd594 Length = 316 Back     alignment and structure
>pdb|2PDK|A Chain A, Human Aldose Reductase Mutant L301m Complexed With Sorbinil. Length = 316 Back     alignment and structure
>pdb|1EL3|A Chain A, Human Aldose Reductase Complexed With Idd384 Inhibitor Length = 316 Back     alignment and structure
>pdb|2PDQ|A Chain A, Human Aldose Reductase Mutant C303d Complexed With Uracil- Type Inhibitor. Length = 316 Back     alignment and structure
>pdb|1ABN|A Chain A, The Crystal Structure Of The Aldose Reductase Nadph Binary Complex Length = 315 Back     alignment and structure
>pdb|3LQG|A Chain A, Human Aldose Reductase Mutant T113a Complexed With Idd388 Length = 316 Back     alignment and structure
>pdb|3CV7|A Chain A, Crystal Structure Of Porcine Aldehyde Reductase Ternary Complex Length = 325 Back     alignment and structure
>pdb|3LD5|A Chain A, Human Aldose Reductase Mutant T113s Complexed With Idd594 Length = 316 Back     alignment and structure
>pdb|3LBO|A Chain A, Human Aldose Reductase Mutant T113c Complexed With Idd594 Length = 316 Back     alignment and structure
>pdb|2AGT|A Chain A, Aldose Reductase Mutant Leu 300 Pro Complexed With Fidarestat Length = 319 Back     alignment and structure
>pdb|2PDI|A Chain A, Human Aldose Reductase Mutant L300a Complexed With Zopolrestat At 1.55 A. Length = 316 Back     alignment and structure
>pdb|2IS7|A Chain A, Crystal Structure Of Aldose Reductase Complexed With Dichlorophenylacetic Acid Length = 315 Back     alignment and structure
>pdb|1Z3N|A Chain A, Human Aldose Reductase In Complex With Nadp+ And The Inhibitor Lidorestat At 1.04 Angstrom Length = 319 Back     alignment and structure
>pdb|2PDB|A Chain A, Human Aldose Reductase Mutant F121p Complexed With Zopolrestat. Length = 316 Back     alignment and structure
>pdb|1EF3|A Chain A, Fidarestat Bound To Human Aldose Reductase Length = 315 Back     alignment and structure
>pdb|2R24|A Chain A, Human Aldose Reductase Structure Length = 316 Back     alignment and structure
>pdb|2PDF|A Chain A, Human Aldose Reductase Mutant L300p Complexed With Zopolrestat. Length = 316 Back     alignment and structure
>pdb|1XGD|A Chain A, Apo R268a Human Aldose Reductase Length = 315 Back     alignment and structure
>pdb|3ONB|A Chain A, Bond Breakage And Relocation Of A Covalently Bound Bromine Of Idd594 In A Complex With Har T113a Mutant After Extensive Radiation Dose Length = 315 Back     alignment and structure
>pdb|3RX2|A Chain A, Crystal Structure Of Human Aldose Reductase Complexed With Sulindac Sulfone Length = 336 Back     alignment and structure
>pdb|1AE4|A Chain A, Aldehyde Reductase Complexed With Cofactor And Inhibitor, Alpha Carbon Atoms Only Length = 325 Back     alignment and structure
>pdb|1CWN|A Chain A, Crystal Structure Of Porcine Aldehyde Reductase Holoenzyme Length = 324 Back     alignment and structure
>pdb|1HQT|A Chain A, The Crystal Structure Of An Aldehyde Reductase Y50f Mutant- Nadp Complex And Its Implications For Substrate Binding Length = 326 Back     alignment and structure
>pdb|2ACU|A Chain A, Tyrosine-48 Is The Proton Donor And Histidine-110 Directs Substrate Stereochemical Selectivity In The Reduction Reaction Of Human Aldose Reductase: Enzyme Kinetics And The Crystal Structure Of The Y48h Mutant Enzyme Length = 315 Back     alignment and structure
>pdb|3KRB|A Chain A, Structure Of Aldose Reductase From Giardia Lamblia At 1.75a Resolution Length = 334 Back     alignment and structure
>pdb|1AH0|A Chain A, Pig Aldose Reductase Complexed With Sorbinil Length = 316 Back     alignment and structure
>pdb|1DLA|A Chain A, Novel Nadph-Binding Domain Revealed By The Crystal Structure Of Aldose Reductase Length = 314 Back     alignment and structure
>pdb|1EKO|A Chain A, Pig Aldose Reductase Complexed With Idd384 Inhibitor Length = 315 Back     alignment and structure
>pdb|3C3U|A Chain A, Crystal Structure Of Akr1c1 In Complex With Nadp And 3,5- Dichlorosalicylic Acid Length = 323 Back     alignment and structure
>pdb|3GUG|A Chain A, Crystal Structure Of Akr1c1 L308v Mutant In Complex With Nadp And 3,5-Dichlorosalicylic Acid Length = 323 Back     alignment and structure
>pdb|1YE4|A Chain A, Crystal Structure Of The Lys-274 To Arg Mutant Of Candida Tenuis Xylose Reductase (Akr2b5) Bound To Nad+ Length = 322 Back     alignment and structure
>pdb|1SM9|A Chain A, Crystal Structure Of An Engineered K274rn276d Double Mutant Of Xylose Reductase From Candida Tenuis Optimized To Utilize Nad Length = 322 Back     alignment and structure
>pdb|1JEZ|A Chain A, The Structure Of Xylose Reductase, A Dimeric Aldo-Keto Reductase From Candida Tenuis Length = 322 Back     alignment and structure
>pdb|1R38|A Chain A, Crystal Structure Of H114a Mutant Of Candida Tenuis Xylose Reductase Length = 322 Back     alignment and structure
>pdb|1Z9A|A Chain A, Crystal Structure Of The Asn-309 To Asp Mutant Of Candida Tenuis Xylose Reductase (Akr2b5) Bound To Nad+ Length = 321 Back     alignment and structure
>pdb|1MRQ|A Chain A, Crystal Structure Of Human 20alpha-hsd In Ternary Complex With Nadp And 20alpha-hydroxy-progesterone Length = 323 Back     alignment and structure
>pdb|1QWK|A Chain A, Structural Genomics Of Caenorhabditis Elegans: Hypothetical 35.2 Kda Protein (Aldose Reductase Family Member) Length = 317 Back     alignment and structure
>pdb|3QKZ|A Chain A, Crystal Structure Of Mutant His269arg Akr1b14 Length = 316 Back     alignment and structure
>pdb|3O3R|A Chain A, Crystal Structure Of Akr1b14 In Complex With Nadp Length = 316 Back     alignment and structure
>pdb|1IHI|A Chain A, Crystal Structure Of Human Type Iii 3-Alpha-Hydroxysteroid DehydrogenaseBILE ACID BINDING PROTEIN (AKR1C2) COMPLEXED With Nadp+ And Ursodeoxycholate Length = 323 Back     alignment and structure
>pdb|1FRB|A Chain A, Fr-1 ProteinNADPHZOPOLRESTAT COMPLEX Length = 315 Back     alignment and structure
>pdb|1J96|A Chain A, Human 3alpha-Hsd Type 3 In Ternary Complex With Nadp And Testosterone Length = 323 Back     alignment and structure
>pdb|1XJB|A Chain A, Crystal Structure Of Human Type 3 3alpha-Hydroxysteroid Dehydrogenase In Complex With Nadp(H), Citrate And Acetate Molecules Length = 325 Back     alignment and structure
>pdb|1C9W|A Chain A, Cho Reductase With Nadp+ Length = 315 Back     alignment and structure
>pdb|1VP5|A Chain A, Crystal Structure Of 2,5-diketo-d-gluconic Acid Reductase (tm1009) From Thermotoga Maritima At 2.40 A Resolution Length = 298 Back     alignment and structure
>pdb|2IPJ|A Chain A, Crystal Structure Of H3alpha-Hydroxysteroid Dehydrogenase Type 3 Mutant Y24a In Complex With Nadp+ And Epi-Testosterone Length = 321 Back     alignment and structure
>pdb|1ZUA|X Chain X, Crystal Structure Of Akr1b10 Complexed With Nadp+ And Tolrestat Length = 317 Back     alignment and structure
>pdb|2BGQ|A Chain A, Apo Aldose Reductase From Barley Length = 344 Back     alignment and structure
>pdb|1Q13|A Chain A, Crystal Structure Of Rabbit 20alpha Hyroxysteroid Dehydrogenase In Ternary Complex With Nadp And Testosterone Length = 323 Back     alignment and structure
>pdb|3BUR|A Chain A, Crystal Structure Of Delta(4)-3-Ketosteroid 5-Beta-Reductase In Complex With Nadp And Testosterone. Resolution: 1.62 A. Length = 326 Back     alignment and structure
>pdb|3UZW|A Chain A, Crystal Structure Of 5beta-Reductase (Akr1d1) E120h Mutant In Complex With Nadp+ Length = 346 Back     alignment and structure
>pdb|3CMF|A Chain A, Crystal Structure Of Human Liver 5beta-Reductase (Akr1d1) In Complex With Nadp And Cortisone. Resolution 1.90 A. Length = 346 Back     alignment and structure
>pdb|3UWE|A Chain A, Akr1c3 Complexed With 3-Phenoxybenzoic Acid Length = 331 Back     alignment and structure
>pdb|3R43|A Chain A, Akr1c3 Complexed With Mefenamic Acid Length = 331 Back     alignment and structure
>pdb|1Q5M|A Chain A, Binary Complex Of Rabbit 20alpha-Hydroxysteroid Dehydrogenase With Nadph Length = 322 Back     alignment and structure
>pdb|1S1P|A Chain A, Crystal Structures Of Prostaglandin D2 11-Ketoreductase (Akr1c3) In Complex With The Non-Steroidal Anti- Inflammatory Drugs Flufenamic Acid And Indomethacin Length = 331 Back     alignment and structure
>pdb|2FVL|A Chain A, Crystal Structure Of Human 3-alpha Hydroxysteroid/dihydrodiol Dehydrogenase (akr1c4) Complexed With Nadp+ Length = 324 Back     alignment and structure
>pdb|1RY0|A Chain A, Structure Of Prostaglandin F Synthase With Prostaglandin D2 Length = 323 Back     alignment and structure
>pdb|3O0K|A Chain A, Crystal Structure Of AldoKETO REDUCTASE FROM BRUCELLA MELITENSIS Length = 283 Back     alignment and structure
>pdb|1MZR|A Chain A, Structure Of Dkga From E.Coli At 2.13 A Resolution Solved By Molecular Replacement Length = 296 Back     alignment and structure
>pdb|1RAL|A Chain A, Three-Dimensional Structure Of Rat Liver 3alpha- Hydroxysteroid(Slash)dihydrodiol Dehydrogenase: A Member Of The Aldo-Keto Reductase Superfamily Length = 308 Back     alignment and structure
>pdb|1AFS|A Chain A, Recombinant Rat Liver 3-Alpha-Hydroxysteroid Dehydrogenase (3-Alpha-Hsd) Complexed With Nadp And Testosterone Length = 323 Back     alignment and structure
>pdb|1LWI|A Chain A, 3-Alpha-HydroxysteroidDIHYDRODIOL DEHYDROGENASE FROM Rattus Norvegicus Length = 322 Back     alignment and structure
>pdb|3LN3|A Chain A, Crystal Structure Of Putative Reductase (Np_038806.2) From Mus Musculus At 1.18 A Resolution Length = 324 Back     alignment and structure
>pdb|1ZGD|A Chain A, Chalcone Reductase Complexed With Nadp+ At 1.7 Angstrom Resolution Length = 312 Back     alignment and structure
>pdb|4FZI|A Chain A, Crystal Structure Of Prostaglandin F Synthase From Trypanosoma Cruzi Length = 290 Back     alignment and structure
>pdb|1M9H|A Chain A, Corynebacterium 2,5-dkgr A And Phe 22 Replaced With Tyr (f22y), Lys 232 Replaced With Gly (k232g), Arg 238 Replaced With His (r238h)and Ala 272 Replaced With Gly (a272g)in Presence Of Nadh Cofactor Length = 278 Back     alignment and structure
>pdb|2IPF|A Chain A, Crystal Structure Of 17alpha-Hydroxysteroid Dehydrogenase In Complex With Nadp+ And Epi-Testosterone Length = 318 Back     alignment and structure
>pdb|3CV6|A Chain A, The Crystal Structure Of Mouse 17-Alpha Hydroxysteroid Dehydrogenase Gg225.226pp Mutant In Complex With Inhibitor And Cofactor Nadp+. Length = 323 Back     alignment and structure
>pdb|2HE5|A Chain A, Crystal Structure Of 17alpha-Hydroxysteroid Dehydrogenase In Binary Complex With Nadp(H) In An Open Conformation Length = 323 Back     alignment and structure
>pdb|2IPG|A Chain A, Crystal Structure Of 17alpha-Hydroxysteroid Dehydrogenase Mutant K31a In Complex With Nadp+ And Epi-Testosterone Length = 319 Back     alignment and structure
>pdb|3FJN|A Chain A, The Crystal Structure Of 17-Alpha Hydroxysteroid Dehydrogenase Y224d Mutant. Length = 323 Back     alignment and structure
>pdb|3UP8|A Chain A, Crystal Structure Of A Putative 2,5-Diketo-D-Gluconic Acid Reductase B Length = 298 Back     alignment and structure
>pdb|1HW6|A Chain A, Crystal Structure Of Apo-2,5-Diketo-D-Gluconate Reductase Length = 278 Back     alignment and structure
>pdb|1A80|A Chain A, Native 2,5-Diketo-D-Gluconic Acid Reductase A From Corynbacterium Sp. Complexed With Nadph Length = 277 Back     alignment and structure
>pdb|4F40|A Chain A, X-Ray Crystal Structure Of Apo Prostaglandin F Synthase From Leishmania Major Friedlin Length = 288 Back     alignment and structure
>pdb|3B3D|A Chain A, B.Subtilis Ytbe Length = 314 Back     alignment and structure
>pdb|3F7J|A Chain A, B.Subtilis Yvgn Length = 276 Back     alignment and structure
>pdb|3D3F|A Chain A, Crystal Structure Of Yvgn And Cofactor Nadph From Bacillus Subtilis Length = 275 Back     alignment and structure
>pdb|1VBJ|A Chain A, The Crystal Structure Of Prostaglandin F Synthase From Trypanosoma Brucei Length = 281 Back     alignment and structure
>pdb|2WZM|A Chain A, Crystal Structure Of A Mycobacterium Aldo-Keto Reductase In Its Apo And Liganded Form Length = 283 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query137
3h7u_A 335 Aldo-keto reductase; stress response, NADP, drough 1e-69
1mi3_A 322 Xylose reductase, XR; aldo-keto reductase, beta-al 1e-69
3o3r_A 316 Aldo-keto reductase family 1, member B7; aldose re 7e-69
1us0_A 316 Aldose reductase; oxidoreductase, NADP, IDD594; HE 3e-68
1afs_A 323 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; 1e-67
1qwk_A 317 Aldose reductase, aldo-keto reductase family 1 mem 2e-67
3buv_A 326 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reduc 4e-67
1s1p_A 331 Aldo-keto reductase family 1 member C3; TIM-barrel 6e-67
3krb_A 334 Aldose reductase; ssgcid, SBRI, emerald biostructu 2e-66
2ao0_A 324 Aldehyde dehydrogenase; TIM barrel, aldo-keto redu 2e-66
3h7r_A 331 Aldo-keto reductase; stress response, NADP, drough 5e-66
2bgs_A 344 Aldose reductase; holoenzyme, aldo/keto reductase, 2e-65
1zgd_A 312 Chalcone reductase; polyketide, deoxychalcone, iso 9e-63
3ln3_A 324 Dihydrodiol dehydrogenase; putative reductase, str 9e-52
1vp5_A 298 2,5-diketo-D-gluconic acid reductase; TM1009, stru 2e-48
4f40_A 288 Prostaglandin F2-alpha synthase/D-arabinose dehyd; 9e-45
3up8_A 298 Putative 2,5-diketo-D-gluconic acid reductase B; n 1e-44
1vbj_A 281 Prostaglandin F synthase; TIM barrel, oxidoreducta 2e-44
4gie_A 290 Prostaglandin F synthase; structural genomics, nia 3e-44
3o0k_A 283 Aldo/keto reductase; ssgcid, ALS collaborative cry 7e-44
3b3e_A 310 YVGN protein; aldo-keto reductase, oxidoreductase; 1e-43
1hw6_A 278 2,5-diketo-D-gluconic acid reductase; aldo-keto re 1e-43
3f7j_A 276 YVGN protein; aldo-keto reductase, oxidoreductase; 4e-43
2wzm_A 283 Aldo-keto reductase; oxidoreductase; HET: NA7; 1.6 4e-43
1mzr_A 296 2,5-diketo-D-gluconate reductase A; alpha/beta-bar 6e-42
3lut_A 367 Voltage-gated potassium channel subunit beta-2; vo 5e-15
3eau_A 327 Voltage-gated potassium channel subunit beta-2; kv 2e-14
3erp_A 353 Putative oxidoreductase; funded by the national in 9e-13
3n6q_A 346 YGHZ aldo-keto reductase; TIM barrel, oxidoreducta 2e-12
3n2t_A 348 Putative oxidoreductase; aldo/keto reductase super 2e-11
1pz1_A 333 GSP69, general stress protein 69; beta-alpha barre 9e-11
1pyf_A 312 IOLS protein; beta-alpha barrel, aldo-keto reducta 2e-10
1ur3_M 319 Hypothetical oxidoreductase YDHF; NADP binding, al 3e-10
1gve_A 327 Aflatoxin B1 aldehyde reductase member 3; oxidored 1e-09
3v0s_A 337 Perakine reductase; AKR superfamily, oxidoreductas 2e-08
2bp1_A 360 Aflatoxin B1 aldehyde reductase member 2; oxidored 4e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-07
1ynp_A 317 Oxidoreductase, AKR11C1; aldo-keto reductase, NADP 2e-07
1lqa_A 346 TAS protein; TIM barrel, structure 2 function proj 5e-04
>3h7u_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.25A {Arabidopsis thaliana} Length = 335 Back     alignment and structure
 Score =  211 bits (540), Expect = 1e-69
 Identities = 84/113 (74%), Positives = 99/113 (87%)

Query: 1   MEEGFRFFKLNAGAKIPSLGLGTWAAAPDVVGDAIAAAVKVGYRHIDCAQIYGNEKGIGS 60
           M     FFKLN GAK PS+GLGTW A+P +VGDA+AAAVK+GYRHIDCAQIYGNEK IG+
Sbjct: 21  MANAITFFKLNTGAKFPSVGLGTWQASPGLVGDAVAAAVKIGYRHIDCAQIYGNEKEIGA 80

Query: 61  ALKKLFDDGVVKREDLWITSKLWCNNHLPEDVPKALDRTLQDLQLDYVDLYLV 113
            LKKLF+D VVKREDL+ITSKLWC +H P+DVP+AL+RTL+DLQL+YVDLYL+
Sbjct: 81  VLKKLFEDRVVKREDLFITSKLWCTDHDPQDVPEALNRTLKDLQLEYVDLYLI 133
>1mi3_A Xylose reductase, XR; aldo-keto reductase, beta-alpha barrel, dimer, oxidoreductase; HET: NAD; 1.80A {Candida tenuis} SCOP: c.1.7.1 PDB: 1jez_A* 1k8c_A* 1ye6_A* 1ye4_A* 1sm9_A* 1r38_A* 1z9a_A* Length = 322 Back     alignment and structure
>3o3r_A Aldo-keto reductase family 1, member B7; aldose reductase like protein, AKR1B14, oxidoreductase; HET: NAP; 1.86A {Rattus norvegicus} PDB: 3qkz_A* Length = 316 Back     alignment and structure
>1us0_A Aldose reductase; oxidoreductase, NADP, IDD594; HET: NDP LDT CIT; 0.66A {Homo sapiens} SCOP: c.1.7.1 PDB: 1pwl_A* 1t41_A* 1pwm_A* 1x96_A* 1x97_A* 1x98_A* 1z89_A* 1z8a_A* 2dux_A* 2duz_A* 2dv0_A* 2fz8_A* 2fz9_A* 2fzb_A* 2fzd_A* 2hv5_A* 2hvn_A* 2hvo_A* 2i16_A* 2i17_A* ... Length = 316 Back     alignment and structure
>1afs_A 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, NAD; HET: NAP TES; 2.50A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 1lwi_A* Length = 323 Back     alignment and structure
>1qwk_A Aldose reductase, aldo-keto reductase family 1 member C1, XH961; structural genomics, PSI, protein structure initiative; 1.60A {Caenorhabditis elegans} SCOP: c.1.7.1 Length = 317 Back     alignment and structure
>3buv_A 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reductase, catalytic tetrad, hepes, NADP, bIle catabolism, disease mutation, lipid metabolism; HET: NAP EPE; 1.35A {Homo sapiens} PDB: 3bur_A* 3bv7_A* 3caq_A* 3cas_A* 3cav_A* 3g1r_A* 3cot_A* 3dop_A* 3cmf_A* 3uzx_A* 3uzw_A* 3uzy_A* 3uzz_A* Length = 326 Back     alignment and structure
>1s1p_A Aldo-keto reductase family 1 member C3; TIM-barrel, oxidoreductase; HET: NAP; 1.20A {Homo sapiens} SCOP: c.1.7.1 PDB: 1s1r_A* 1s2a_A* 1s2c_A* 3uwe_A* 3r58_A* 3r43_A* 3r7m_A* 3r6i_A* 3r8h_A* 3r94_A* 3r8g_A* 1zq5_A* 1ry8_A* 1xf0_A* 1ry0_A* 2f38_A* 2fgb_A* 4dbs_A* 4dbu_A* 3gug_A* ... Length = 331 Back     alignment and structure
>3krb_A Aldose reductase; ssgcid, SBRI, emerald biostructures, university of washingto niaid, oxidoreductase, S genomics; HET: NAP; 1.75A {Giardia lamblia} Length = 334 Back     alignment and structure
>3h7r_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.40A {Arabidopsis thaliana} Length = 331 Back     alignment and structure
>2bgs_A Aldose reductase; holoenzyme, aldo/keto reductase, oxidoreductase; HET: NDP; 1.64A {Hordeum vulgare} PDB: 2bgq_A* 2vdg_A* Length = 344 Back     alignment and structure
>1zgd_A Chalcone reductase; polyketide, deoxychalcone, isoflavonoid, biosynthesis, plant protein; HET: NAP; 1.70A {Medicago sativa} Length = 312 Back     alignment and structure
>3ln3_A Dihydrodiol dehydrogenase; putative reductase, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: MLY MSE NAD; 1.18A {Mus musculus} Length = 324 Back     alignment and structure
>1vp5_A 2,5-diketo-D-gluconic acid reductase; TM1009, structural genomics, joint center for structural genomics, PSI, protein structure initiative; HET: NAP; 2.40A {Thermotoga maritima} SCOP: c.1.7.1 Length = 298 Back     alignment and structure
>4f40_A Prostaglandin F2-alpha synthase/D-arabinose dehyd; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: CIT; 1.60A {Leishmania major} Length = 288 Back     alignment and structure
>3up8_A Putative 2,5-diketo-D-gluconic acid reductase B; nysgrc, PSI-biology, structural genomics; 1.96A {Sinorhizobium meliloti} Length = 298 Back     alignment and structure
>1vbj_A Prostaglandin F synthase; TIM barrel, oxidoreductase; HET: NAP CIT; 2.10A {Trypanosoma brucei} Length = 281 Back     alignment and structure
>4gie_A Prostaglandin F synthase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: NAP; 1.25A {Trypanosoma cruzi} PDB: 4fzi_A* Length = 290 Back     alignment and structure
>3o0k_A Aldo/keto reductase; ssgcid, ALS collaborative crystallography; 1.80A {Brucella melitensis biovar} Length = 283 Back     alignment and structure
>1hw6_A 2,5-diketo-D-gluconic acid reductase; aldo-keto reductase, TIM barrel, oxidoreductase; 1.90A {Corynebacterium SP} SCOP: c.1.7.1 PDB: 1a80_A* 1m9h_A* Length = 278 Back     alignment and structure
>3f7j_A YVGN protein; aldo-keto reductase, oxidoreductase; 1.70A {Bacillus subtilis} PDB: 3d3f_A* Length = 276 Back     alignment and structure
>2wzm_A Aldo-keto reductase; oxidoreductase; HET: NA7; 1.64A {Mycobacterium smegmatis} PDB: 2wzt_A Length = 283 Back     alignment and structure
>1mzr_A 2,5-diketo-D-gluconate reductase A; alpha/beta-barrel, aldo-ketoreductase, NADPH dependant, BACT targets at IGS-CNRS, france, BIGS; 2.13A {Escherichia coli} SCOP: c.1.7.1 Length = 296 Back     alignment and structure
>3lut_A Voltage-gated potassium channel subunit beta-2; voltage gating, potassium channel, KV1.2, gating charges, no analysis, ION transport; HET: NAP; 2.90A {Rattus norvegicus} Length = 367 Back     alignment and structure
>3eau_A Voltage-gated potassium channel subunit beta-2; kvbeta, cortisone, NADPH, cytoplasm, ION transport, ionic channel, NADP, phosphoprotein; HET: NDP PDN; 1.82A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2r9r_A* 2a79_A* 3lnm_A* 1exb_A* 3eb4_A* 3eb3_A* 1qrq_A* 1zsx_A* Length = 327 Back     alignment and structure
>3erp_A Putative oxidoreductase; funded by the national institute of allergy and infectious D of NIH contract number HHSN272200700058C; 1.55A {Salmonella enterica subsp} Length = 353 Back     alignment and structure
>3n6q_A YGHZ aldo-keto reductase; TIM barrel, oxidoreductase; 1.80A {Escherichia coli} Length = 346 Back     alignment and structure
>3n2t_A Putative oxidoreductase; aldo/keto reductase superfamily, AKR, AKR11B4, TIM barrel; 2.00A {Gluconobacter oxydans} Length = 348 Back     alignment and structure
>1pz1_A GSP69, general stress protein 69; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; HET: NAP; 2.20A {Bacillus subtilis} SCOP: c.1.7.1 Length = 333 Back     alignment and structure
>1pyf_A IOLS protein; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; 1.80A {Bacillus subtilis} SCOP: c.1.7.1 PDB: 1pz0_A* Length = 312 Back     alignment and structure
>1ur3_M Hypothetical oxidoreductase YDHF; NADP binding, aldo-keto reductase; 2.57A {Escherichia coli} SCOP: c.1.7.1 PDB: 1og6_A* Length = 319 Back     alignment and structure
>1gve_A Aflatoxin B1 aldehyde reductase member 3; oxidoreductase, aldo-keto reductase, succinic semialdehyde oxidoreductase, AKR7 family; HET: NAP CIT; 1.38A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2clp_A* 2c91_A* Length = 327 Back     alignment and structure
>3v0s_A Perakine reductase; AKR superfamily, oxidoreductase; HET: MLZ M3L MLY ATR; 1.77A {Rauvolfia serpentina} PDB: 3v0u_A 3v0t_A* 3uyi_A* Length = 337 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1ynp_A Oxidoreductase, AKR11C1; aldo-keto reductase, NADPH; HET: SUC; 1.25A {Bacillus halodurans} PDB: 1ynq_A* Length = 317 Back     alignment and structure
>1lqa_A TAS protein; TIM barrel, structure 2 function project, S2F, structural GE oxidoreductase; HET: NDP; 1.60A {Escherichia coli} SCOP: c.1.7.1 Length = 346 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query137
4gie_A 290 Prostaglandin F synthase; structural genomics, nia 100.0
3ln3_A 324 Dihydrodiol dehydrogenase; putative reductase, str 100.0
3o0k_A 283 Aldo/keto reductase; ssgcid, ALS collaborative cry 100.0
3h7u_A 335 Aldo-keto reductase; stress response, NADP, drough 100.0
1mi3_A 322 Xylose reductase, XR; aldo-keto reductase, beta-al 100.0
3f7j_A 276 YVGN protein; aldo-keto reductase, oxidoreductase; 100.0
1hw6_A 278 2,5-diketo-D-gluconic acid reductase; aldo-keto re 100.0
3b3e_A 310 YVGN protein; aldo-keto reductase, oxidoreductase; 100.0
3up8_A 298 Putative 2,5-diketo-D-gluconic acid reductase B; n 100.0
1qwk_A 317 Aldose reductase, aldo-keto reductase family 1 mem 100.0
1afs_A 323 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; 100.0
2wzm_A 283 Aldo-keto reductase; oxidoreductase; HET: NA7; 1.6 100.0
3o3r_A 316 Aldo-keto reductase family 1, member B7; aldose re 100.0
1vbj_A 281 Prostaglandin F synthase; TIM barrel, oxidoreducta 100.0
1zgd_A 312 Chalcone reductase; polyketide, deoxychalcone, iso 100.0
3h7r_A 331 Aldo-keto reductase; stress response, NADP, drough 100.0
1s1p_A 331 Aldo-keto reductase family 1 member C3; TIM-barrel 100.0
3buv_A 326 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reduc 100.0
4f40_A 288 Prostaglandin F2-alpha synthase/D-arabinose dehyd; 100.0
3b3d_A 314 YTBE protein, putative morphine dehydrogenase; ald 100.0
1us0_A 316 Aldose reductase; oxidoreductase, NADP, IDD594; HE 100.0
1mzr_A 296 2,5-diketo-D-gluconate reductase A; alpha/beta-bar 100.0
1vp5_A 298 2,5-diketo-D-gluconic acid reductase; TM1009, stru 100.0
2bgs_A 344 Aldose reductase; holoenzyme, aldo/keto reductase, 100.0
3krb_A 334 Aldose reductase; ssgcid, SBRI, emerald biostructu 100.0
4gac_A 324 Alcohol dehydrogenase [NADP(+)]; TIM barrel, aldhe 100.0
3eau_A 327 Voltage-gated potassium channel subunit beta-2; kv 100.0
1ynp_A 317 Oxidoreductase, AKR11C1; aldo-keto reductase, NADP 100.0
1ur3_M 319 Hypothetical oxidoreductase YDHF; NADP binding, al 100.0
4exb_A 292 Putative uncharacterized protein; aldo-keto reduct 100.0
1pyf_A 312 IOLS protein; beta-alpha barrel, aldo-keto reducta 100.0
3v0s_A 337 Perakine reductase; AKR superfamily, oxidoreductas 100.0
3lut_A 367 Voltage-gated potassium channel subunit beta-2; vo 100.0
3n6q_A 346 YGHZ aldo-keto reductase; TIM barrel, oxidoreducta 100.0
3n2t_A 348 Putative oxidoreductase; aldo/keto reductase super 100.0
1pz1_A 333 GSP69, general stress protein 69; beta-alpha barre 100.0
3erp_A 353 Putative oxidoreductase; funded by the national in 100.0
1lqa_A 346 TAS protein; TIM barrel, structure 2 function proj 99.98
1gve_A 327 Aflatoxin B1 aldehyde reductase member 3; oxidored 99.97
2bp1_A 360 Aflatoxin B1 aldehyde reductase member 2; oxidored 99.97
3l23_A 303 Sugar phosphate isomerase/epimerase; structural ge 81.65
>4gie_A Prostaglandin F synthase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: NAP; 1.25A {Trypanosoma cruzi} PDB: 4fzi_A* Back     alignment and structure
Probab=100.00  E-value=2e-38  Score=240.30  Aligned_cols=127  Identities=34%  Similarity=0.678  Sum_probs=118.8

Q ss_pred             CCCCCceeeCCCCCccccceeecccCC-hhHHHHHHHHHHHcCCCeeeCcccccCHHHHHHHHHhhhhCCCCCCCcEEEE
Q 032577            1 MEEGFRFFKLNAGAKIPSLGLGTWAAA-PDVVGDAIAAAVKVGYRHIDCAQIYGNEKGIGSALKKLFDDGVVKREDLWIT   79 (137)
Q Consensus         1 m~~~~~~~~l~~g~~v~~lglGt~~~~-~~~~~~~l~~a~~~G~~~~Dta~~Yg~e~~~G~~l~~~~~~~~~~r~~~~i~   79 (137)
                      |+.+|++++|+||++||.||||||+.. .+++.++|+.|+++|||+||||+.||||+.+|++++..   + .+|++++++
T Consensus         9 m~~~~~~v~Ln~G~~ip~lGlGtw~~~d~~e~~~~v~~Al~~Gin~~DTA~~YgsE~~vG~~l~~~---~-~~r~~~~i~   84 (290)
T 4gie_A            9 MNCNYNCVTLHNSVRMPQLGLGVWRAQDGAETANAVRWAIEAGYRHIDTAYIYSNERGVGQGIRES---G-VPREEVWVT   84 (290)
T ss_dssp             CSSSSCEEECTTSCEEESBCEECTTCCTTHHHHHHHHHHHHHTCCEEECCGGGTCHHHHHHHHHHH---C-CCGGGSEEE
T ss_pred             cCCCCCEEEcCCCCCccceeEECCCCCCHHHHHHHHHHHHHcCCCEEecccccCCHHHHHHHHHhc---C-Ccchhcccc
Confidence            899999999999999999999999885 56899999999999999999999999999999999976   4 689999999


Q ss_pred             eccCCCCCCchhHHHHHHHHHHHcCCCceeEEEEeecCCCCchHHHHHHHHH
Q 032577           80 SKLWCNNHLPEDVPKALDRTLQDLQLDYVDLYLVCLYDTIQHLFIFHLLIEV  131 (137)
Q Consensus        80 tK~~~~~~~~~~i~~~~~~sL~~L~~~~lDl~~lH~p~~~~~~~~~~~l~~~  131 (137)
                      ||+++...+++.+++++++||++||+||||+|++|||+.....+.|++|.++
T Consensus        85 tk~~~~~~~~~~~~~~~e~SL~rL~~dyiDly~lH~p~~~~~~e~~~al~~l  136 (290)
T 4gie_A           85 TKVWNSDQGYEKTLAAFERSRELLGLEYIDLYLIHWPGKKKFVDTWKALEKL  136 (290)
T ss_dssp             EEECGGGCSHHHHHHHHHHHHHHHTCSCEEEEEECCCCSSSHHHHHHHHHHH
T ss_pred             ccccccCCChHHHHHHHHHHHHHhCCCceeeEEecCCCCCcchHHHHHHHHH
Confidence            9999888899999999999999999999999999999988888888887765
>3ln3_A Dihydrodiol dehydrogenase; putative reductase, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: MLY MSE NAD; 1.18A {Mus musculus} SCOP: c.1.7.1 Back     alignment and structure
>3o0k_A Aldo/keto reductase; ssgcid, ALS collaborative crystallography; 1.80A {Brucella melitensis biovar} Back     alignment and structure
>3h7u_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.25A {Arabidopsis thaliana} Back     alignment and structure
>1mi3_A Xylose reductase, XR; aldo-keto reductase, beta-alpha barrel, dimer, oxidoreductase; HET: NAD; 1.80A {Candida tenuis} SCOP: c.1.7.1 PDB: 1jez_A* 1k8c_A* 1ye6_A* 1ye4_A* 1sm9_A* 1r38_A* 1z9a_A* Back     alignment and structure
>3f7j_A YVGN protein; aldo-keto reductase, oxidoreductase; 1.70A {Bacillus subtilis} PDB: 3d3f_A* Back     alignment and structure
>1hw6_A 2,5-diketo-D-gluconic acid reductase; aldo-keto reductase, TIM barrel, oxidoreductase; 1.90A {Corynebacterium SP} SCOP: c.1.7.1 PDB: 1a80_A* 1m9h_A* Back     alignment and structure
>3up8_A Putative 2,5-diketo-D-gluconic acid reductase B; nysgrc, PSI-biology, structural genomics; 1.96A {Sinorhizobium meliloti} Back     alignment and structure
>1qwk_A Aldose reductase, aldo-keto reductase family 1 member C1, XH961; structural genomics, PSI, protein structure initiative; 1.60A {Caenorhabditis elegans} SCOP: c.1.7.1 Back     alignment and structure
>1afs_A 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, NAD; HET: NAP TES; 2.50A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 1lwi_A* Back     alignment and structure
>2wzm_A Aldo-keto reductase; oxidoreductase; HET: NA7; 1.64A {Mycobacterium smegmatis} PDB: 2wzt_A Back     alignment and structure
>3o3r_A Aldo-keto reductase family 1, member B7; aldose reductase like protein, AKR1B14, oxidoreductase; HET: NAP; 1.86A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 3qkz_A* Back     alignment and structure
>1vbj_A Prostaglandin F synthase; TIM barrel, oxidoreductase; HET: NAP CIT; 2.10A {Trypanosoma brucei} Back     alignment and structure
>1zgd_A Chalcone reductase; polyketide, deoxychalcone, isoflavonoid, biosynthesis, plant protein; HET: NAP; 1.70A {Medicago sativa} Back     alignment and structure
>3h7r_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.40A {Arabidopsis thaliana} Back     alignment and structure
>1s1p_A Aldo-keto reductase family 1 member C3; TIM-barrel, oxidoreductase; HET: NAP; 1.20A {Homo sapiens} SCOP: c.1.7.1 PDB: 1s1r_A* 1s2a_A* 1s2c_A* 3uwe_A* 3r58_A* 3r43_A* 3r7m_A* 3r6i_A* 3r8h_A* 3r94_A* 3r8g_A* 1zq5_A* 1ry8_A* 1xf0_A* 1ry0_A* 2f38_A* 2fgb_A* 4dbs_A* 4dbu_A* 3gug_A* ... Back     alignment and structure
>3buv_A 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reductase, catalytic tetrad, hepes, NADP, bIle catabolism, disease mutation, lipid metabolism; HET: NAP EPE; 1.35A {Homo sapiens} PDB: 3bur_A* 3bv7_A* 3caq_A* 3cas_A* 3cav_A* 3g1r_A* 3cot_A* 3dop_A* 3cmf_A* 3uzx_A* 3uzw_A* 3uzy_A* 3uzz_A* Back     alignment and structure
>4f40_A Prostaglandin F2-alpha synthase/D-arabinose dehyd; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: CIT; 1.60A {Leishmania major} PDB: 4g5d_A* Back     alignment and structure
>3b3d_A YTBE protein, putative morphine dehydrogenase; aldo-keto reductase, oxidoreductase; 2.30A {Bacillus subtilis} Back     alignment and structure
>1us0_A Aldose reductase; oxidoreductase, NADP, IDD594; HET: NDP LDT CIT; 0.66A {Homo sapiens} SCOP: c.1.7.1 PDB: 1pwl_A* 1t41_A* 1pwm_A* 1x96_A* 1x97_A* 1x98_A* 1z89_A* 1z8a_A* 2dux_A* 2duz_A* 2dv0_A* 2fz8_A* 2fz9_A* 2fzb_A* 2fzd_A* 2hv5_A* 2hvn_A* 2hvo_A* 2i16_A* 2i17_A* ... Back     alignment and structure
>1mzr_A 2,5-diketo-D-gluconate reductase A; alpha/beta-barrel, aldo-ketoreductase, NADPH dependant, BACT targets at IGS-CNRS, france, BIGS; 2.13A {Escherichia coli} SCOP: c.1.7.1 Back     alignment and structure
>1vp5_A 2,5-diketo-D-gluconic acid reductase; TM1009, structural genomics, joint center for structural genomics, PSI, protein structure initiative; HET: NAP; 2.40A {Thermotoga maritima} SCOP: c.1.7.1 Back     alignment and structure
>2bgs_A Aldose reductase; holoenzyme, aldo/keto reductase, oxidoreductase; HET: NDP; 1.64A {Hordeum vulgare} PDB: 2bgq_A* 2vdg_A* Back     alignment and structure
>3krb_A Aldose reductase; ssgcid, SBRI, emerald biostructures, university of washingto niaid, oxidoreductase, S genomics; HET: NAP; 1.75A {Giardia lamblia} Back     alignment and structure
>4gac_A Alcohol dehydrogenase [NADP(+)]; TIM barrel, aldheyde reductase AKR1A4, SMAR1, oxidoreductase; HET: FLC; 1.64A {Mus musculus} PDB: 2alr_A 3h4g_A* 3cv7_A* 3fx4_A* 1ae4_A* 1cwn_A* 1hqt_A* Back     alignment and structure
>3eau_A Voltage-gated potassium channel subunit beta-2; kvbeta, cortisone, NADPH, cytoplasm, ION transport, ionic channel, NADP, phosphoprotein; HET: NDP PDN; 1.82A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2r9r_A* 2a79_A* 3lnm_A* 1exb_A* 3eb4_A* 3eb3_A* 1qrq_A* 1zsx_A* Back     alignment and structure
>1ynp_A Oxidoreductase, AKR11C1; aldo-keto reductase, NADPH; HET: SUC; 1.25A {Bacillus halodurans} PDB: 1ynq_A* Back     alignment and structure
>1ur3_M Hypothetical oxidoreductase YDHF; NADP binding, aldo-keto reductase; 2.57A {Escherichia coli} SCOP: c.1.7.1 PDB: 1og6_A* Back     alignment and structure
>4exb_A Putative uncharacterized protein; aldo-keto reductase, NADP+ binding, oxidoreducta; 2.75A {Pseudomonas aeruginosa} PDB: 4exa_A Back     alignment and structure
>1pyf_A IOLS protein; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; 1.80A {Bacillus subtilis} SCOP: c.1.7.1 PDB: 1pz0_A* Back     alignment and structure
>3v0s_A Perakine reductase; AKR superfamily, oxidoreductase; HET: MLZ M3L MLY ATR; 1.77A {Rauvolfia serpentina} PDB: 3v0u_A 3v0t_A* 3uyi_A* Back     alignment and structure
>3lut_A Voltage-gated potassium channel subunit beta-2; voltage gating, potassium channel, KV1.2, gating charges, no analysis, ION transport; HET: NAP; 2.90A {Rattus norvegicus} Back     alignment and structure
>3n6q_A YGHZ aldo-keto reductase; TIM barrel, oxidoreductase; 1.80A {Escherichia coli} SCOP: c.1.7.0 PDB: 4ast_A 4aub_A* Back     alignment and structure
>3n2t_A Putative oxidoreductase; aldo/keto reductase superfamily, AKR, AKR11B4, TIM barrel; 2.00A {Gluconobacter oxydans} SCOP: c.1.7.0 Back     alignment and structure
>1pz1_A GSP69, general stress protein 69; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; HET: NAP; 2.20A {Bacillus subtilis} SCOP: c.1.7.1 Back     alignment and structure
>3erp_A Putative oxidoreductase; funded by the national institute of allergy and infectious D of NIH contract number HHSN272200700058C; 1.55A {Salmonella enterica subsp} Back     alignment and structure
>1lqa_A TAS protein; TIM barrel, structure 2 function project, S2F, structural GE oxidoreductase; HET: NDP; 1.60A {Escherichia coli} SCOP: c.1.7.1 Back     alignment and structure
>1gve_A Aflatoxin B1 aldehyde reductase member 3; oxidoreductase, aldo-keto reductase, succinic semialdehyde oxidoreductase, AKR7 family; HET: NAP CIT; 1.38A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2clp_A* 2c91_A* Back     alignment and structure
>3l23_A Sugar phosphate isomerase/epimerase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.70A {Parabacteroides distasonis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 137
d1qwka_ 312 c.1.7.1 (A:) Hypothetical protein C07D8.6 {Nematod 3e-29
d1us0a_ 314 c.1.7.1 (A:) Aldose reductase (aldehyde reductase) 4e-29
d1frba_ 315 c.1.7.1 (A:) FR-1 (fibroblast growth factor-induce 7e-29
d1mi3a_ 319 c.1.7.1 (A:) Xylose reductase {Fungi (Candida tenu 2e-28
d1afsa_ 319 c.1.7.1 (A:) 3-alpha-hydroxysteroid dehydrogenase 3e-27
d1vp5a_ 284 c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase 5e-27
d1s1pa_ 315 c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (ak 2e-26
d1hqta_ 324 c.1.7.1 (A:) Aldose reductase (aldehyde reductase) 2e-26
d1mzra_ 274 c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase 3e-22
d1hw6a_ 262 c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase 8e-22
d3eaua1 326 c.1.7.1 (A:36-361) Voltage-dependent K+ channel be 9e-18
d1lqaa_ 346 c.1.7.1 (A:) Tas protein {Escherichia coli [TaxId: 7e-15
d1gvea_ 324 c.1.7.1 (A:) Aflatoxin aldehyde reductase (akr7a1) 6e-13
d1pyfa_ 311 c.1.7.1 (A:) Putative oxidoreductase IolS {Bacillu 2e-12
d1pz1a_ 333 c.1.7.1 (A:) Putative oxidoreductase YhdN {Bacillu 1e-11
d1ur3m_ 298 c.1.7.1 (M:) Hypothetical oxidoreductase YdhF {Esc 9e-11
>d1qwka_ c.1.7.1 (A:) Hypothetical protein C07D8.6 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 312 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: NAD(P)-linked oxidoreductase
family: Aldo-keto reductases (NADP)
domain: Hypothetical protein C07D8.6
species: Nematode (Caenorhabditis elegans) [TaxId: 6239]

 Score =  105 bits (263), Expect = 3e-29
 Identities = 53/118 (44%), Positives = 76/118 (64%)

Query: 9   KLNAGAKIPSLGLGTWAAAPDVVGDAIAAAVKVGYRHIDCAQIYGNEKGIGSALKKLFDD 68
           KL+ G ++P +GLGTW ++P  V  A+  AVK GYR ID A +Y NE+ IG+A+K+L ++
Sbjct: 5   KLSNGVEMPVIGLGTWQSSPAEVITAVKTAVKAGYRLIDTASVYQNEEAIGTAIKELLEE 64

Query: 69  GVVKREDLWITSKLWCNNHLPEDVPKALDRTLQDLQLDYVDLYLVCLYDTIQHLFIFH 126
           GVVKRE+L+IT+K W +   P  +   L  +L+ LQL+YVDLYL  +          H
Sbjct: 65  GVVKREELFITTKAWTHELAPGKLEGGLRESLKKLQLEYVDLYLAHMPAAFNDDMSEH 122
>d1us0a_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Human (Homo sapiens) [TaxId: 9606]} Length = 314 Back     information, alignment and structure
>d1frba_ c.1.7.1 (A:) FR-1 (fibroblast growth factor-induced) protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 315 Back     information, alignment and structure
>d1mi3a_ c.1.7.1 (A:) Xylose reductase {Fungi (Candida tenuis) [TaxId: 45596]} Length = 319 Back     information, alignment and structure
>d1afsa_ c.1.7.1 (A:) 3-alpha-hydroxysteroid dehydrogenase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 319 Back     information, alignment and structure
>d1vp5a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Thermotoga maritima [TaxId: 2336]} Length = 284 Back     information, alignment and structure
>d1s1pa_ c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (akr1c3) {Human (Homo sapiens) [TaxId: 9606]} Length = 315 Back     information, alignment and structure
>d1hqta_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Pig (Sus scrofa) [TaxId: 9823]} Length = 324 Back     information, alignment and structure
>d1mzra_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Escherichia coli [TaxId: 562]} Length = 274 Back     information, alignment and structure
>d1hw6a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Corynebacterium sp. [TaxId: 1720]} Length = 262 Back     information, alignment and structure
>d3eaua1 c.1.7.1 (A:36-361) Voltage-dependent K+ channel beta subunit {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 326 Back     information, alignment and structure
>d1lqaa_ c.1.7.1 (A:) Tas protein {Escherichia coli [TaxId: 562]} Length = 346 Back     information, alignment and structure
>d1pyfa_ c.1.7.1 (A:) Putative oxidoreductase IolS {Bacillus subtilis [TaxId: 1423]} Length = 311 Back     information, alignment and structure
>d1pz1a_ c.1.7.1 (A:) Putative oxidoreductase YhdN {Bacillus subtilis [TaxId: 1423]} Length = 333 Back     information, alignment and structure
>d1ur3m_ c.1.7.1 (M:) Hypothetical oxidoreductase YdhF {Escherichia coli [TaxId: 562]} Length = 298 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query137
d1vp5a_ 284 2,5-diketo-D-gluconic acid reductase A {Thermotoga 100.0
d1hw6a_ 262 2,5-diketo-D-gluconic acid reductase A {Corynebact 100.0
d1qwka_ 312 Hypothetical protein C07D8.6 {Nematode (Caenorhabd 100.0
d1mi3a_ 319 Xylose reductase {Fungi (Candida tenuis) [TaxId: 4 100.0
d1ur3m_ 298 Hypothetical oxidoreductase YdhF {Escherichia coli 99.98
d1afsa_ 319 3-alpha-hydroxysteroid dehydrogenase {Rat (Rattus 99.98
d1mzra_ 274 2,5-diketo-D-gluconic acid reductase A {Escherichi 99.98
d1s1pa_ 315 Prostaglandin d2 11-ketoreductase (akr1c3) {Human 99.97
d1frba_ 315 FR-1 (fibroblast growth factor-induced) protein {M 99.97
d1us0a_ 314 Aldose reductase (aldehyde reductase) {Human (Homo 99.97
d3eaua1 326 Voltage-dependent K+ channel beta subunit {Rat (Ra 99.96
d1hqta_ 324 Aldose reductase (aldehyde reductase) {Pig (Sus sc 99.96
d1pz1a_ 333 Putative oxidoreductase YhdN {Bacillus subtilis [T 99.96
d1pyfa_ 311 Putative oxidoreductase IolS {Bacillus subtilis [T 99.96
d1gvea_ 324 Aflatoxin aldehyde reductase (akr7a1) {Rat (Rattus 99.95
d1lqaa_ 346 Tas protein {Escherichia coli [TaxId: 562]} 99.94
>d1vp5a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: NAD(P)-linked oxidoreductase
family: Aldo-keto reductases (NADP)
domain: 2,5-diketo-D-gluconic acid reductase A
species: Thermotoga maritima [TaxId: 2336]

Probab=100.00  E-value=8.6e-34  Score=211.86  Aligned_cols=130  Identities=36%  Similarity=0.636  Sum_probs=115.7

Q ss_pred             CCceeeCCCCCccccceeecccCChhHHHHHHHHHHHcCCCeeeCcccccCHHHHHHHHHhhhhCCCCCCCcEEEEeccC
Q 032577            4 GFRFFKLNAGAKIPSLGLGTWAAAPDVVGDAIAAAVKVGYRHIDCAQIYGNEKGIGSALKKLFDDGVVKREDLWITSKLW   83 (137)
Q Consensus         4 ~~~~~~l~~g~~v~~lglGt~~~~~~~~~~~l~~a~~~G~~~~Dta~~Yg~e~~~G~~l~~~~~~~~~~r~~~~i~tK~~   83 (137)
                      ++|+++||||.+||+||||||+++.+++.++|+.|+++|||+||||+.||+|..+|++|++...++.+.|+.+++.+|.+
T Consensus         1 ~ip~~~l~tG~~vs~iglGt~~~~~~~~~~~i~~A~d~Gin~~DTA~~YgsE~~~G~~l~~~~~~~~~~~~~~~i~~~~~   80 (284)
T d1vp5a_           1 QVPKVTLNNGVEMPILGYGVFQIPPEKTEECVYEAIKVGYRLIDTAASYMNEEGVGRAIKRAIDEGIVRREELFVTTKLW   80 (284)
T ss_dssp             CCCEEECTTSCEEESBCEECTTCCHHHHHHHHHHHHHHTCCEEECCGGGTCHHHHHHHHHHHHHTTSCCGGGCEEEEEEC
T ss_pred             CCCeEECCCCCEecceeeECCCCCHHHHHHHHHHHHHcCCCEEEcCcccCCHHHHHHHHHhhhccccccccccccccccc
Confidence            36889999999999999999999999999999999999999999999999999999999988776667899999999998


Q ss_pred             CCCCCchhHHHHHHHHHHHcCCCceeEEEEeecCCCCchHHHHHHH---HHHhh
Q 032577           84 CNNHLPEDVPKALDRTLQDLQLDYVDLYLVCLYDTIQHLFIFHLLI---EVSLR  134 (137)
Q Consensus        84 ~~~~~~~~i~~~~~~sL~~L~~~~lDl~~lH~p~~~~~~~~~~~l~---~~~~~  134 (137)
                      ....+++.+++++++||++||+||||++++|+|+... .+.|++|.   +.|+.
T Consensus        81 ~~~~~~~~~~~~~~~SL~rL~~d~iD~~~~H~p~~~~-~~~~~al~~l~~~GkI  133 (284)
T d1vp5a_          81 VSDVGYESTKKAFEKSLKKLQLEYIDLYLIHQPFGDV-HCAWKAMEEMYKDGLV  133 (284)
T ss_dssp             GGGCSSHHHHHHHHHHHHHHTCSCEEEEEECSSCSCH-HHHHHHHHHHHHTTSE
T ss_pred             ccccCcHHHHHHHHHHHHHhccCchhhhhccccccch-hhHHHHHHHHhhCCeE
Confidence            8888999999999999999999999999999997643 34455544   44544
>d1hw6a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Corynebacterium sp. [TaxId: 1720]} Back     information, alignment and structure
>d1qwka_ c.1.7.1 (A:) Hypothetical protein C07D8.6 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1mi3a_ c.1.7.1 (A:) Xylose reductase {Fungi (Candida tenuis) [TaxId: 45596]} Back     information, alignment and structure
>d1ur3m_ c.1.7.1 (M:) Hypothetical oxidoreductase YdhF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1afsa_ c.1.7.1 (A:) 3-alpha-hydroxysteroid dehydrogenase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1mzra_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s1pa_ c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (akr1c3) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1frba_ c.1.7.1 (A:) FR-1 (fibroblast growth factor-induced) protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1us0a_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3eaua1 c.1.7.1 (A:36-361) Voltage-dependent K+ channel beta subunit {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hqta_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1pz1a_ c.1.7.1 (A:) Putative oxidoreductase YhdN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1pyfa_ c.1.7.1 (A:) Putative oxidoreductase IolS {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1lqaa_ c.1.7.1 (A:) Tas protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure