Citrus Sinensis ID: 032590


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------
MRADFKKRYGGGKADTAIAKSLNKEFGPIMKEHMKYIIDHAEEIEKLIKVKAQVSEVKSIMLENIDKAVDRGENIQNLADKTENLREQAQAYKKAGTQIRRKMWYQNMKIKLVVLGILLILVLIIWLSVCHGFDCTN
cHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccc
*RADFKKRYG******AI**SLNKEFGPIMKEHMKYIIDHAEEIEKLIKVKAQVSEVKSIMLENIDKAVDRGENIQNLA************YKKAGTQIRRKMWYQNMKIKLVVLGILLILVLIIWLSVCHGFDCT*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRADFKKRYGGGKADTAIAKSLNKEFGPIMKEHMKYIIDHAEEIEKLIKVKAQVSEVKSIMLENIDKAVDRGENxxxxxxxxxxxxxxxxxxxxxGTQIRRKMWYQNMKIKLVVLGILLILVLIIWLSVCHGFDCTN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Vesicle-associated membrane protein 724 Involved in the targeting and/or fusion of transport vesicles to their target membrane.probableO23429

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3HD7, chain A
Confidence level:very confident
Coverage over the Query: 44-130
View the alignment between query and template
View the model in PyMOL
Template: 4B93, chain A
Confidence level:very confident
Coverage over the Query: 1-84
View the alignment between query and template
View the model in PyMOL