Citrus Sinensis ID: 032617

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------

MASSSHRGGAGGPFYGGAAPYRSREGLTTRPVAGSDEIQLRIDPVNADLDDEITGLRSQVKQLRNVAQEIHSEASFQKDFLDQLQMTLIKAQAGVKNNMRRLNKSIVKHGSNHIMHVVLFALFLFFILYMWSKMFRR

ccccccccccccccccccccccccccccccccccccHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHcc

***************************************LRIDPVNADL**EITGLRSQVKQLRNVAQEIHSEASFQKDFLDQLQMTLIKAQAGVKNNMRRLNKSIVKHGSNHIMHVVLFALFLFFILYMWSKMFRR

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MASSSHRGGAGGPFYGGAAPYRSREGLTTRPVAGSDEIQLRIDPVxxxxxxxxxxxxxxxxxxxxxAQEIHSEASFQKDFLDQLQMTLIKAQAGVKNNMRRLNKSIVKHGSNHIMHVVLFALFLFFILYMWSKMFRR

Annotation	Function Description	Confidence Level	Reference Protein
Bet1-like protein At4g14600	Required for vesicular transport from the ER to the Golgi complex. Functions as a SNARE associated with ER-derived vesicles.	confident	Q8VXX9
Bet1-like protein At1g29060	Required for vesicular transport from the ER to the Golgi complex. Functions as a SNARE associated with ER-derived vesicles.	probable	Q8L9S0

No EC number assigned to the protein, probably not an enzyme!

Template: 2NPS, chain D
Confidence level:confident
Coverage over the Query: 50-112
View the alignment between query and template
View the model in PyMOL