Citrus Sinensis ID: 032623


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------
MATKTLIRTGASLLNRLVSSKPNTLLVHQSNTAHHHQFPSLSKIQTSLYLPSSSDSVSLTRVASQGFLYPSGLPSLEFYLPNGNLSDEPMLLFPKRTFQPSTIRRKRNHGFFARKATKGGRRVIARRIAKGRSRITA
cHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccHHHcccHHHHcccccHHHHHHHHHHcccccccc
**********************************************************LTRVASQGFLYPSGLPSLEFYLPNGNLSDEPMLLFPKRTFQPSTIRRKRNHGFFARKATKGGRRVIARRIA********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATKTLIRTGASLLNRLVSSKPNTLLVHQSNTAHHHQFPSLSKIQTSLYLPSSSDSVSLTRVASQGFLYPSGLPSLEFYLPNGNLSDEPMLLFPKRTFQPSTIRRKRNHGFFARKATKGGRRVIARRIAKGRSRITA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
50S ribosomal protein L34 probableQ48BE9
50S ribosomal protein L34 probableA4VS85
50S ribosomal protein L34 probableC3K1G4

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3R8S, chain 2
Confidence level:confident
Coverage over the Query: 94-137
View the alignment between query and template
View the model in PyMOL