Citrus Sinensis ID: 032650

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130------
MLLPRQTISHCKINGYDVYPETLLQVNVWAIGRDSRYWSKAEEFFPERFIDNSVDFKGQNFELLPFGGGRRICPGIQMGISTVELALTNLLYHFNWKLPNGMEGGDLNMEEAIGQSLTTSKKTPLMLVPINYSHPK
cccccccccccEEccEEcccccEEEEEEEEEcccccccccccccccccccccccccccccccEEcccccccccccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccEEEcccccEEEEEEcccccc
cccccHHcccEEEccEEcccccEEEEEEEEEcccccccccHHHcccHHHcccccccccccEEEEcccccccccccHHHHHHHHHHHHHHHHHHccccccccccHHHccccccccEEEEEEccccEEEEEccccccc
mllprqtishckingydvypetllQVNVWAIgrdsrywskaeeffperfidnsvdfkgqnfellpfgggrricpgiqmGISTVELALTNLLYHfnwklpngmeggdlnmeEAIGQslttskktplmlvpinyshpk
mllprqtishckingydvypeTLLQVNVWAIGRDSRYWSKAEEFFPERFIDNSVDFKGQNFELLPFGGGRRICPGIQMGISTVELALTNLLYHFNWKLPNGMEGGDLNMEEAIGQSlttskktplmlvpinyshpk
MLLPRQTISHCKINGYDVYPETLLQVNVWAIGRDSRYWSKAEEFFPERFIDNSVDFKGQNFELLPFGGGRRICPGIQMGISTVELALTNLLYHFNWKLPNGMEGGDLNMEEAIGQSLTTSKKTPLMLVPINYSHPK
******TISHCKINGYDVYPETLLQVNVWAIGRDSRYWSKAEEFFPERFIDNSVDFKGQNFELLPFGGGRRICPGIQMGISTVELALTNLLYHFNWKLPNGM**********************************
MLLPRQTISHCKINGYDVYPETLLQVNVWAIGRDSRYWSKAEEFFPERFIDNSVDFKGQNFELLPFGGGRRICPGIQMGISTVELALTNLLYHFNWKLPNGMEGGDLNMEEAIGQSLTTSKKTPLMLVPINYS***
MLLPRQTISHCKINGYDVYPETLLQVNVWAIGRDSRYWSKAEEFFPERFIDNSVDFKGQNFELLPFGGGRRICPGIQMGISTVELALTNLLYHFNWKLPNGMEGGDLNMEEAIGQSLTTSKKTPLMLVPINYSHPK
MLLPRQTISHCKINGYDVYPETLLQVNVWAIGRDSRYWSKAEEFFPERFIDNSVDFKGQNFELLPFGGGRRICPGIQMGISTVELALTNLLYHFNWKLPNGMEGGDLNMEEAIGQSLTTSKKTPLMLVPINY****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLLPRQTISHCKINGYDVYPETLLQVNVWAIGRDSRYWSKAEEFFPERFIDNSVDFKGQNFELLPFGGGRRICPGIQMGISTVELALTNLLYHFNWKLPNGMEGGDLNMEEAIGQSLTTSKKTPLMLVPINYSHPK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query136 2.2.26 [Sep-21-2011]
O65788502 Cytochrome P450 71B2 OS=A no no 0.941 0.254 0.576 1e-42
Q9LVD2502 Cytochrome P450 71B10 OS= no no 0.948 0.256 0.595 3e-42
Q9LTM3502 Cytochrome P450 71B20 OS= no no 0.948 0.256 0.580 2e-41
Q9LIP6500 Cytochrome P450 71B34 OS= no no 0.977 0.266 0.570 3e-41
Q9LIP5500 Cytochrome P450 71B35 OS= no no 0.933 0.254 0.604 2e-40
Q9LTL8498 Cytochrome P450 71B24 OS= no no 0.926 0.253 0.592 3e-40
Q9LTM4502 Cytochrome P450 71B19 OS= no no 0.948 0.256 0.564 4e-40
Q9LTM7502 Cytochrome P450 71B16 OS= no no 0.948 0.256 0.572 7e-40
O64718500 Cytochrome P450 71B9 OS=A no no 0.926 0.252 0.570 8e-40
Q9LTL0500 Cytochrome P450 71B26 OS= no no 0.926 0.252 0.585 1e-38
>sp|O65788|C71B2_ARATH Cytochrome P450 71B2 OS=Arabidopsis thaliana GN=CYP71B2 PE=2 SV=2 Back     alignment and function desciption
 Score =  171 bits (433), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 75/130 (57%), Positives = 104/130 (80%), Gaps = 2/130 (1%)

Query: 2   LLPRQTISHCKINGYDVYPETLLQVNVWAIGRDSRYWSKAEEFFPERFIDNSVDFKGQNF 61
           ++PR+T+SH KI GYD+ P+T +Q+NVW IGRD + W+  EEF PERF ++SVDF+GQ+F
Sbjct: 373 VVPRETMSHIKIQGYDIPPKTQIQLNVWTIGRDPKRWNDPEEFNPERFANSSVDFRGQHF 432

Query: 62  ELLPFGGGRRICPGIQMGISTVELALTNLLYHFNWKLPNGMEGGDLNMEEAIGQSLTTSK 121
           +LLPFG GRRICPG+ M I++VELAL NLLY+F+W +P+G +G D++MEEA   +++  K
Sbjct: 433 DLLPFGSGRRICPGMPMAIASVELALMNLLYYFDWSMPDGTKGEDIDMEEA--GNISIVK 490

Query: 122 KTPLMLVPIN 131
           K PL LVP+ 
Sbjct: 491 KIPLQLVPVQ 500

Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 1EC: 4EC: .EC: -EC: .EC: -
>sp|Q9LVD2|C71BA_ARATH Cytochrome P450 71B10 OS=Arabidopsis thaliana GN=CYP71B10 PE=3 SV=1 Back     alignment and function description
>sp|Q9LTM3|C71BK_ARATH Cytochrome P450 71B20 OS=Arabidopsis thaliana GN=CYP71B20 PE=2 SV=1 Back     alignment and function description
>sp|Q9LIP6|C71BV_ARATH Cytochrome P450 71B34 OS=Arabidopsis thaliana GN=CYP71B34 PE=2 SV=1 Back     alignment and function description
>sp|Q9LIP5|C71BW_ARATH Cytochrome P450 71B35 OS=Arabidopsis thaliana GN=CYP71B35 PE=2 SV=1 Back     alignment and function description
>sp|Q9LTL8|C71BO_ARATH Cytochrome P450 71B24 OS=Arabidopsis thaliana GN=CYP71B24 PE=2 SV=1 Back     alignment and function description
>sp|Q9LTM4|C71BJ_ARATH Cytochrome P450 71B19 OS=Arabidopsis thaliana GN=CYP71B19 PE=2 SV=1 Back     alignment and function description
>sp|Q9LTM7|C71BG_ARATH Cytochrome P450 71B16 OS=Arabidopsis thaliana GN=CYP71B16 PE=3 SV=1 Back     alignment and function description
>sp|O64718|C71B9_ARATH Cytochrome P450 71B9 OS=Arabidopsis thaliana GN=CYP71B9 PE=2 SV=3 Back     alignment and function description
>sp|Q9LTL0|C71BQ_ARATH Cytochrome P450 71B26 OS=Arabidopsis thaliana GN=CYP71B26 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query136
224102389 482 cytochrome P450 [Populus trichocarpa] gi 0.970 0.273 0.651 2e-50
118485719 507 unknown [Populus trichocarpa] 0.970 0.260 0.651 3e-50
224102385 482 cytochrome P450 [Populus trichocarpa] gi 0.970 0.273 0.643 6e-50
224103253188 cytochrome P450 [Populus trichocarpa] gi 0.970 0.702 0.651 6e-50
224102403 482 cytochrome P450 [Populus trichocarpa] gi 0.970 0.273 0.636 4e-49
16507125 500 cytochrome P450 [Citrus sinensis] 0.970 0.264 0.664 5e-47
255578379 507 cytochrome P450, putative [Ricinus commu 0.970 0.260 0.621 6e-47
147818696 505 hypothetical protein VITISV_023587 [Viti 0.941 0.253 0.676 8e-46
225424609 505 PREDICTED: cytochrome P450 71B35-like [V 0.941 0.253 0.661 4e-45
449435432 504 PREDICTED: cytochrome P450 71B19-like [C 0.970 0.261 0.598 8e-45
>gi|224102389|ref|XP_002312660.1| cytochrome P450 [Populus trichocarpa] gi|222852480|gb|EEE90027.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  203 bits (517), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 86/132 (65%), Positives = 111/132 (84%)

Query: 1   MLLPRQTISHCKINGYDVYPETLLQVNVWAIGRDSRYWSKAEEFFPERFIDNSVDFKGQN 60
           +L+PR+T+SHCK++G+++YP+ L+Q+NVWAIGRD RYW   EEFFPERF+D S+D+KGQ+
Sbjct: 349 LLIPRETMSHCKVSGHNIYPKMLVQINVWAIGRDPRYWKDPEEFFPERFLDRSIDYKGQS 408

Query: 61  FELLPFGGGRRICPGIQMGISTVELALTNLLYHFNWKLPNGMEGGDLNMEEAIGQSLTTS 120
           FE LPFG GRRICPG+ MG  T+E+ L NLLY F+W  P+GM+  D+NMEE  G SLTTS
Sbjct: 409 FEYLPFGSGRRICPGMHMGSITMEIILANLLYCFDWVFPDGMKKEDINMEEKAGVSLTTS 468

Query: 121 KKTPLMLVPINY 132
           KKTPL+LVP+NY
Sbjct: 469 KKTPLILVPVNY 480

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|118485719|gb|ABK94709.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224102385|ref|XP_002312659.1| cytochrome P450 [Populus trichocarpa] gi|222852479|gb|EEE90026.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224103253|ref|XP_002334073.1| cytochrome P450 [Populus trichocarpa] gi|222839789|gb|EEE78112.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224102403|ref|XP_002312665.1| cytochrome P450 [Populus trichocarpa] gi|222852485|gb|EEE90032.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|16507125|gb|AAL24049.1|AF426451_1 cytochrome P450 [Citrus sinensis] Back     alignment and taxonomy information
>gi|255578379|ref|XP_002530056.1| cytochrome P450, putative [Ricinus communis] gi|223530472|gb|EEF32356.1| cytochrome P450, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|147818696|emb|CAN60733.1| hypothetical protein VITISV_023587 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225424609|ref|XP_002285456.1| PREDICTED: cytochrome P450 71B35-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|449435432|ref|XP_004135499.1| PREDICTED: cytochrome P450 71B19-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query136
TAIR|locus:2031900502 CYP71B2 ""cytochrome P450, fam 0.933 0.252 0.589 5.3e-40
TAIR|locus:2165595502 CYP71B10 ""cytochrome P450, fa 0.941 0.254 0.6 1.4e-39
TAIR|locus:2065254500 CYP71B9 ""cytochrome P450, fam 0.955 0.26 0.575 1.8e-39
TAIR|locus:2093501502 CYP71B17 ""cytochrome P450, fa 0.941 0.254 0.592 2.9e-39
TAIR|locus:2093516502 CYP71B20 ""cytochrome P450, fa 0.941 0.254 0.592 6.1e-39
TAIR|locus:2079251500 CYP71B34 ""cytochrome P450, fa 0.977 0.266 0.570 9.9e-39
TAIR|locus:2079306500 CYP71B35 ""cytochrome P450, fa 0.933 0.254 0.604 2.6e-38
TAIR|locus:2093561500 CYP71B26 ""cytochrome P450, fa 0.955 0.26 0.590 3.4e-38
TAIR|locus:2093556498 CYP71B24 ""cytochrome P450, fa 0.926 0.253 0.6 4.3e-38
TAIR|locus:2093491502 CYP71B16 ""cytochrome P450, fa 0.941 0.254 0.584 5.5e-38
TAIR|locus:2031900 CYP71B2 ""cytochrome P450, family 71, subfamily B, polypeptide 2"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 426 (155.0 bits), Expect = 5.3e-40, P = 5.3e-40
 Identities = 76/129 (58%), Positives = 105/129 (81%)

Query:     2 LLPRQTISHCKINGYDVYPETLLQVNVWAIGRDSRYWSKAEEFFPERFIDNSVDFKGQNF 61
             ++PR+T+SH KI GYD+ P+T +Q+NVW IGRD + W+  EEF PERF ++SVDF+GQ+F
Sbjct:   373 VVPRETMSHIKIQGYDIPPKTQIQLNVWTIGRDPKRWNDPEEFNPERFANSSVDFRGQHF 432

Query:    62 ELLPFGGGRRICPGIQMGISTVELALTNLLYHFNWKLPNGMEGGDLNMEEAIGQSLTTSK 121
             +LLPFG GRRICPG+ M I++VELAL NLLY+F+W +P+G +G D++MEEA G +++  K
Sbjct:   433 DLLPFGSGRRICPGMPMAIASVELALMNLLYYFDWSMPDGTKGEDIDMEEA-G-NISIVK 490

Query:   122 KTPLMLVPI 130
             K PL LVP+
Sbjct:   491 KIPLQLVPV 499
GO:0005506 "iron ion binding" evidence=IEA
GO:0005576 "extracellular region" evidence=ISM
GO:0009055 "electron carrier activity" evidence=IEA
GO:0016705 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen" evidence=IEA
GO:0019825 "oxygen binding" evidence=ISS
GO:0020037 "heme binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0010286 "heat acclimation" evidence=IEP
TAIR|locus:2165595 CYP71B10 ""cytochrome P450, family 71, subfamily B, polypeptide 10"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2065254 CYP71B9 ""cytochrome P450, family 71, subfamily B, polypeptide 9"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2093501 CYP71B17 ""cytochrome P450, family 71, subfamily B, polypeptide 17"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2093516 CYP71B20 ""cytochrome P450, family 71, subfamily B, polypeptide 20"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2079251 CYP71B34 ""cytochrome P450, family 71, subfamily B, polypeptide 34"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2079306 CYP71B35 ""cytochrome P450, family 71, subfamily B, polypeptide 35"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2093561 CYP71B26 ""cytochrome P450, family 71, subfamily B, polypeptide 26"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2093556 CYP71B24 ""cytochrome P450, family 71, subfamily B, polypeptide 24"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2093491 CYP71B16 ""cytochrome P450, family 71, subfamily B, polypeptide 16"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query136
PLN03234499 PLN03234, PLN03234, cytochrome P450 83B1; Provisio 2e-39
PLN00110504 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F 4e-38
PLN02687517 PLN02687, PLN02687, flavonoid 3'-monooxygenase 2e-37
PLN02966502 PLN02966, PLN02966, cytochrome P450 83A1 5e-37
PLN02183516 PLN02183, PLN02183, ferulate 5-hydroxylase 7e-37
pfam00067461 pfam00067, p450, Cytochrome P450 2e-28
PLN03112514 PLN03112, PLN03112, cytochrome P450 family protein 7e-28
PLN02394503 PLN02394, PLN02394, trans-cinnamate 4-monooxygenas 2e-22
PLN02655466 PLN02655, PLN02655, ent-kaurene oxidase 8e-19
PLN00168519 PLN00168, PLN00168, Cytochrome P450; Provisional 7e-16
COG2124411 COG2124, CypX, Cytochrome P450 [Secondary metaboli 3e-11
PTZ00404482 PTZ00404, PTZ00404, cytochrome P450; Provisional 7e-10
PLN02936489 PLN02936, PLN02936, epsilon-ring hydroxylase 2e-09
PLN02738633 PLN02738, PLN02738, carotene beta-ring hydroxylase 9e-09
PLN02971543 PLN02971, PLN02971, tryptophan N-hydroxylase 1e-08
PLN02987472 PLN02987, PLN02987, Cytochrome P450, family 90, su 7e-07
PLN03018534 PLN03018, PLN03018, homomethionine N-hydroxylase 3e-06
PLN02774463 PLN02774, PLN02774, brassinosteroid-6-oxidase 4e-05
PLN02290516 PLN02290, PLN02290, cytokinin trans-hydroxylase 6e-05
PLN02500490 PLN02500, PLN02500, cytochrome P450 90B1 7e-05
PLN02169500 PLN02169, PLN02169, fatty acid (omega-1)-hydroxyla 1e-04
PLN02302490 PLN02302, PLN02302, ent-kaurenoic acid oxidase 5e-04
PLN03141452 PLN03141, PLN03141, 3-epi-6-deoxocathasterone 23-m 0.002
>gnl|CDD|178773 PLN03234, PLN03234, cytochrome P450 83B1; Provisional Back     alignment and domain information 
 Score =  137 bits (347), Expect = 2e-39
 Identities = 65/135 (48%), Positives = 88/135 (65%), Gaps = 5/135 (3%)

Query: 1   MLLPRQTISHCKINGYDVYPETLLQVNVWAIGRDSRYW-SKAEEFFPERFID--NSVDFK 57
           +LL R+TI+  KI GYD+  +T++QVN WA+ RD+  W     EF PERF+     VDFK
Sbjct: 366 ILLHRETIADAKIGGYDIPAKTIIQVNAWAVSRDTAAWGDNPNEFIPERFMKEHKGVDFK 425

Query: 58  GQNFELLPFGGGRRICPGIQMGISTVELALTNLLYHFNWKLPNGMEGGDLNMEEAIGQSL 117
           GQ+FELLPFG GRR+CP + +GI+ VE+   NLLY F+W LP G++  D+ M+   G  L
Sbjct: 426 GQDFELLPFGSGRRMCPAMHLGIAMVEIPFANLLYKFDWSLPKGIKPEDIKMDVMTG--L 483

Query: 118 TTSKKTPLMLVPINY 132
              KK  L+L P  +
Sbjct: 484 AMHKKEHLVLAPTKH 498

Length = 499
>gnl|CDD|177725 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>gnl|CDD|215371 PLN02687, PLN02687, flavonoid 3'-monooxygenase Back     alignment and domain information
>gnl|CDD|178550 PLN02966, PLN02966, cytochrome P450 83A1 Back     alignment and domain information
>gnl|CDD|165828 PLN02183, PLN02183, ferulate 5-hydroxylase Back     alignment and domain information
>gnl|CDD|215689 pfam00067, p450, Cytochrome P450 Back     alignment and domain information
>gnl|CDD|215583 PLN03112, PLN03112, cytochrome P450 family protein; Provisional Back     alignment and domain information
>gnl|CDD|215221 PLN02394, PLN02394, trans-cinnamate 4-monooxygenase Back     alignment and domain information
>gnl|CDD|215354 PLN02655, PLN02655, ent-kaurene oxidase Back     alignment and domain information
>gnl|CDD|215086 PLN00168, PLN00168, Cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|225035 COG2124, CypX, Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|173595 PTZ00404, PTZ00404, cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|178524 PLN02936, PLN02936, epsilon-ring hydroxylase Back     alignment and domain information
>gnl|CDD|215393 PLN02738, PLN02738, carotene beta-ring hydroxylase Back     alignment and domain information
>gnl|CDD|166612 PLN02971, PLN02971, tryptophan N-hydroxylase Back     alignment and domain information
>gnl|CDD|166628 PLN02987, PLN02987, Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>gnl|CDD|178592 PLN03018, PLN03018, homomethionine N-hydroxylase Back     alignment and domain information
>gnl|CDD|178373 PLN02774, PLN02774, brassinosteroid-6-oxidase Back     alignment and domain information
>gnl|CDD|215164 PLN02290, PLN02290, cytokinin trans-hydroxylase Back     alignment and domain information
>gnl|CDD|215276 PLN02500, PLN02500, cytochrome P450 90B1 Back     alignment and domain information
>gnl|CDD|177826 PLN02169, PLN02169, fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>gnl|CDD|215171 PLN02302, PLN02302, ent-kaurenoic acid oxidase Back     alignment and domain information
>gnl|CDD|215600 PLN03141, PLN03141, 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 136
KOG0158499 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subf 99.98
KOG0156489 consensus Cytochrome P450 CYP2 subfamily [Secondar 99.97
PLN02183516 ferulate 5-hydroxylase 99.97
PLN03234499 cytochrome P450 83B1; Provisional 99.97
KOG0157497 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfami 99.97
PLN02966502 cytochrome P450 83A1 99.97
PLN02687517 flavonoid 3'-monooxygenase 99.97
PLN02394503 trans-cinnamate 4-monooxygenase 99.97
PTZ00404482 cytochrome P450; Provisional 99.97
PLN00168519 Cytochrome P450; Provisional 99.97
PF00067463 p450: Cytochrome P450 p450 superfamily signature b 99.97
PLN00110504 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional 99.97
PLN02169500 fatty acid (omega-1)-hydroxylase/midchain alkane h 99.97
PLN03112514 cytochrome P450 family protein; Provisional 99.97
PLN02971543 tryptophan N-hydroxylase 99.97
PLN02290516 cytokinin trans-hydroxylase 99.96
PLN02500490 cytochrome P450 90B1 99.96
PLN02738633 carotene beta-ring hydroxylase 99.96
PLN02655466 ent-kaurene oxidase 99.96
PLN03195516 fatty acid omega-hydroxylase; Provisional 99.96
PLN03141452 3-epi-6-deoxocathasterone 23-monooxygenase; Provis 99.96
PLN02774463 brassinosteroid-6-oxidase 99.96
PLN03018534 homomethionine N-hydroxylase 99.96
PLN02426502 cytochrome P450, family 94, subfamily C protein 99.96
PLN02302490 ent-kaurenoic acid oxidase 99.96
PLN02936489 epsilon-ring hydroxylase 99.96
PLN02987472 Cytochrome P450, family 90, subfamily A 99.95
PLN02196463 abscisic acid 8'-hydroxylase 99.95
KOG0159519 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 99.95
KOG0684486 consensus Cytochrome P450 [Secondary metabolites b 99.93
COG2124411 CypX Cytochrome P450 [Secondary metabolites biosyn 99.92
PLN02648480 allene oxide synthase 99.89
>KOG0158 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information 
Probab=99.98  E-value=4.9e-32  Score=209.42  Aligned_cols=126  Identities=27%  Similarity=0.438  Sum_probs=109.6

Q ss_pred             cceeecCCeEEc-CEEeCCCCEEEEeehhhccCCCCCCCCCCccCCCcCCCCcCCCCCccceeecCCCCCCCcChHHHHH
Q 032650            3 LPRQTISHCKIN-GYDVYPETLLQVNVWAIGRDSRYWSKAEEFFPERFIDNSVDFKGQNFELLPFGGGRRICPGIQMGIS   81 (136)
Q Consensus         3 i~R~~~~d~~l~-g~~ip~g~~v~~~~~~~~~d~~~~~~p~~f~p~R~~~~~~~~~~~~~~~~~fg~G~r~C~G~~~a~~   81 (136)
                      +.|++++|+++. ++.|++|+.|+++.+++||||++|+||++|+||||+.++.. ...+..|+|||.|+|+|+|++||++
T Consensus       373 ~~R~C~k~~~i~~~~~i~kG~~V~Ip~~alH~Dp~~~p~Pe~F~PERF~~~~~~-~~~~~~ylPFG~GPR~CIGmRfa~m  451 (499)
T KOG0158|consen  373 LNRECTKDYEIPGGFVIPKGTPVMIPTYALHHDPEYWPEPEKFKPERFEEENNK-SRHPGAYLPFGVGPRNCIGMRFALM  451 (499)
T ss_pred             ccceecCceecCCCeEeCCCCEEEeecccccCCcccCCCcccCCCccCCCCccc-ccCCccccCCCCCccccHHHHHHHH
Confidence            579999999999 99999999999999999999999999999999999976543 4467789999999999999999999


Q ss_pred             HHHHHHHHHHHhceeecCCCCCCCCCCcccccCceeeeccCCCeEEEeecCC
Q 032650           82 TVELALTNLLYHFNWKLPNGMEGGDLNMEEAIGQSLTTSKKTPLMLVPINYS  133 (136)
Q Consensus        82 ~~~~~l~~ll~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~r~  133 (136)
                      |+|++|+.||++|+++..+.+. .. ......+  .++.|.+++++++.+|.
T Consensus       452 q~K~~L~~lL~~f~~~~~~~t~-~~-~~~~~~~--~~l~pk~gi~Lkl~~r~  499 (499)
T KOG0158|consen  452 EAKLALAHLLRNFSFEVCPTTI-IP-LEGDPKG--FTLSPKGGIWLKLEPRD  499 (499)
T ss_pred             HHHHHHHHHHhhCEEecCCccc-Cc-ccCCccc--eeeecCCceEEEEEeCC
Confidence            9999999999999999988332 22 2222225  78899999999999884

>KOG0156 consensus Cytochrome P450 CYP2 subfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02183 ferulate 5-hydroxylase Back     alignment and domain information
>PLN03234 cytochrome P450 83B1; Provisional Back     alignment and domain information
>KOG0157 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfamilies [Secondary metabolites biosynthesis, transport and catabolism; Lipid transport and metabolism] Back     alignment and domain information
>PLN02966 cytochrome P450 83A1 Back     alignment and domain information
>PLN02687 flavonoid 3'-monooxygenase Back     alignment and domain information
>PLN02394 trans-cinnamate 4-monooxygenase Back     alignment and domain information
>PTZ00404 cytochrome P450; Provisional Back     alignment and domain information
>PLN00168 Cytochrome P450; Provisional Back     alignment and domain information
>PF00067 p450: Cytochrome P450 p450 superfamily signature b-class p450 signature mitochondrial p450 signature E-class p450 group I signature E-class p450 group II signature E-class p450 group IV signature; InterPro: IPR001128 Cytochrome P450 enzymes are a superfamily of haem-containing mono-oxygenases that are found in all kingdoms of life, and which show extraordinary diversity in their reaction chemistry Back     alignment and domain information
>PLN00110 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>PLN02169 fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>PLN03112 cytochrome P450 family protein; Provisional Back     alignment and domain information
>PLN02971 tryptophan N-hydroxylase Back     alignment and domain information
>PLN02290 cytokinin trans-hydroxylase Back     alignment and domain information
>PLN02500 cytochrome P450 90B1 Back     alignment and domain information
>PLN02738 carotene beta-ring hydroxylase Back     alignment and domain information
>PLN02655 ent-kaurene oxidase Back     alignment and domain information
>PLN03195 fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>PLN03141 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>PLN02774 brassinosteroid-6-oxidase Back     alignment and domain information
>PLN03018 homomethionine N-hydroxylase Back     alignment and domain information
>PLN02426 cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>PLN02302 ent-kaurenoic acid oxidase Back     alignment and domain information
>PLN02936 epsilon-ring hydroxylase Back     alignment and domain information
>PLN02987 Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>PLN02196 abscisic acid 8'-hydroxylase Back     alignment and domain information
>KOG0159 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG0684 consensus Cytochrome P450 [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG2124 CypX Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PLN02648 allene oxide synthase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query136
1w0e_A485 Crystal Structure Of Human Cytochrome P450 3a4 Leng 6e-10
1tqn_A486 Crystal Structure Of Human Microsomal P450 3a4 Leng 7e-10
3ua1_A487 Crystal Structure Of The Cytochrome P4503a4-Bromoer 7e-10
3c6g_A479 Crystal Structure Of Cyp2r1 In Complex With Vitamin 2e-09
3czh_A481 Crystal Structure Of Cyp2r1 In Complex With Vitamin 3e-09
2f9q_A479 Crystal Structure Of Human Cytochrome P450 2d6 Leng 1e-08
3qm4_A479 Human Cytochrome P450 (Cyp) 2d6 - Prinomastat Compl 1e-08
3ruk_A494 Human Cytochrome P450 Cyp17a1 In Complex With Abira 4e-08
4gqs_A477 Structure Of Human Microsomal Cytochrome P450 (cyp) 5e-08
1dt6_A473 Structure Of Mammalian Cytochrome P450 2c5 Length = 5e-08
1r9o_A477 Crystal Structure Of P4502c9 With Flurbiprofen Boun 1e-07
1og2_A475 Structure Of Human Cytochrome P450 Cyp2c9 Length = 2e-07
2hi4_A495 Crystal Structure Of Human Microsomal P450 1a2 In C 2e-07
4i8v_A491 Human Cytochrome P450 1a1 In Complex With Alpha-nap 3e-07
2ve3_A444 Retinoic Acid Bound Cyanobacterial Cyp120a1 Length 4e-07
3hf2_A482 Crystal Structure Of The I401p Mutant Of Cytochrome 6e-07
3mzs_A486 Crystal Structure Of Cytochrome P450 Cyp11a1 In Com 2e-06
4dvq_A483 Structure Of Human Aldosterone Synthase, Cyp11b2, I 2e-06
1pq2_A476 Crystal Structure Of Human Drug Metabolizing Cytoch 2e-06
3ibd_A476 Crystal Structure Of A Cytochrome P450 2b6 Genetic 3e-06
3kx4_A470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 5e-06
3qi8_B472 Evolved Variant Of Cytochrome P450 (Bm3, Cyp102a1) 5e-06
3qz1_A496 Crystal Structure Of Bovine Steroid Of 21-Hydroxyla 7e-06
4du2_B470 Cytochrome P450 Bm3h-B7 Mri Sensor Bound To Dopamin 8e-06
2nnb_A471 The Q403k Mutnat Heme Domain Of Flavocytochrome P45 8e-06
3ekb_A470 Crystal Structure Of The A264c Mutant Heme Domain O 8e-06
2ij3_A470 Structure Of The A264h Mutant Of Cytochrome P450 Bm 9e-06
3kx3_A470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 9e-06
3ekd_A470 Crystal Structure Of The A264m Heme Domain Of Cytoc 9e-06
3m4v_A482 Crystal Structure Of The A330p Mutant Of Cytochrome 9e-06
2ij2_A470 Atomic Structure Of The Heme Domain Of Flavocytochr 9e-06
1smi_A471 A Single Mutation Of P450 Bm3 Induces The Conformat 9e-06
3kx5_A470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 9e-06
3e4e_A476 Human Cytochrome P450 2e1 In Complex With The Inhib 9e-06
3ekf_A470 Crystal Structure Of The A264q Heme Domain Of Cytoc 9e-06
3ben_A470 Structure Of N-(12-Imidazolyl-Dodecanoyl)-L-Leucine 9e-06
1jpz_A473 Crystal Structure Of A Complex Of The Heme Domain O 9e-06
2ij4_A470 Structure Of The A264k Mutant Of Cytochrome P450 Bm 9e-06
2hpd_A471 Crystal Structure Of Hemoprotein Domain Of P450bm-3 9e-06
4dtw_B469 Cytochrome P450 Bm3h-8c8 Mri Sensor Bound To Seroto 9e-06
3npl_A470 Structure Of Ru(Bpy)2(A-Phen)(K97c) P450 Bm3 Heme D 9e-06
1zo4_A473 Crystal Structure Of A328s Mutant Of The Heme Domai 9e-06
1zoa_A473 Crystal Structure Of A328v Mutant Of The Heme Domai 9e-06
1fah_A471 Structure Of Cytochrome P450 Length = 471 9e-06
3pm0_A507 Structural Characterization Of The Complex Between 1e-05
3psx_A487 Crystal Structure Of The Kt2 Mutant Of Cytochrome P 2e-05
2x7y_A455 P450 Bm3 F87a In Complex With Dmso Length = 455 2e-05
1yqp_A455 T268n Mutant Cytochrome Domain Of Flavocytochrome P 2e-05
3dgi_A461 Crystal Structure Of F87aT268A MUTANT OF CYP BM3 Le 2e-05
1yqo_A455 T268a Mutant Heme Domain Of Flavocytochrome P450 Bm 2e-05
2bmh_A455 Modeling Protein-Substrate Interactions In The Heme 2e-05
2uwh_A458 Cytochrome P450 Bm3 Mutant In Complex With Palmitic 2e-05
1bvy_A458 Complex Of The Heme And Fmn-Binding Domains Of The 2e-05
4duf_A471 Cytochrome P450 Bm3h-2g9 Mri Sensor Bound To Seroto 2e-05
4duc_A472 Cytochrome P450 Bm3h-2g9 Mri Sensor, No Ligand Leng 2e-05
4dud_A471 Cytochrome P450 Bm3h-2g9c6 Mri Sensor, No Ligand Le 2e-05
4dub_A472 Cytochrome P450 Bm3h-9d7 Mri Sensor Bound To Dopami 3e-05
4dua_A471 Cytochrome P450 Bm3h-9d7 Mri Sensor, No Ligand Leng 3e-05
3cbd_A455 Directed Evolution Of Cytochrome P450 Bm3, To Octan 4e-05
2p85_A476 Structure Of Human Lung Cytochrome P450 2a13 With I 4e-05
1p0x_A455 F393y Mutant Heme Domain Of Flavocytochrome P450 Bm 4e-05
3n9y_A487 Crystal Structure Of Human Cyp11a1 In Complex With 4e-05
3na0_A471 Crystal Structure Of Human Cyp11a1 In Complex With 4e-05
1izo_A417 Cytochrome P450 Bs Beta Complexed With Fatty Acid L 9e-05
1p0w_A455 F393w Mutant Heme Domain Of Flavocytochrome P450 Bm 1e-04
1jme_A455 Crystal Structure Of Phe393his Cytochrome P450 Bm3 1e-04
1p0v_A455 F393a Mutant Heme Domain Of Flavocytochrome P450 Bm 1e-04
3tk3_A476 Cytochrome P450 2b4 Mutant L437a In Complex With 4- 2e-04
1po5_A476 Structure Of Mammalian Cytochrome P450 2b4 Length = 5e-04
4h1n_A479 Crystal Structure Of P450 2b4 F297a Mutant In Compl 5e-04
2q6n_A478 Structure Of Cytochrome P450 2b4 With Bound 1-(4- C 5e-04
1suo_A476 Structure Of Mammalian Cytochrome P450 2b4 With Bou 5e-04
>pdb|1W0E|A Chain A, Crystal Structure Of Human Cytochrome P450 3a4 Length = 485 Back     alignment and structure 
Iteration: 1

 Score = 59.3 bits (142), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 31/97 (31%), Positives = 53/97 (54%), Gaps = 1/97 (1%)
Query: 1   MLLPRQTISHCKINGYDVYPETLLQVNVWAIGRDSRYWSKAEEFFPERFIDNSVDFKGQN 60
           M L R      +ING  +    ++ +  +A+ RD +YW++ E+F PERF   + D     
Sbjct: 349 MRLERVCKKDVEINGMFIPKGVVVMIPSYALHRDPKYWTEPEKFLPERFSKKNKD-NIDP 407
Query: 61  FELLPFGGGRRICPGIQMGISTVELALTNLLYHFNWK 97
           +   PFG G R C G++  +  ++LAL  +L +F++K
Sbjct: 408 YIYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFSFK 444
>pdb|1TQN|A Chain A, Crystal Structure Of Human Microsomal P450 3a4 Length = 486 Back     alignment and structure
>pdb|3UA1|A Chain A, Crystal Structure Of The Cytochrome P4503a4-Bromoergocryptine Complex Length = 487 Back     alignment and structure
>pdb|3C6G|A Chain A, Crystal Structure Of Cyp2r1 In Complex With Vitamin D3 Length = 479 Back     alignment and structure
>pdb|3CZH|A Chain A, Crystal Structure Of Cyp2r1 In Complex With Vitamin D2 Length = 481 Back     alignment and structure
>pdb|2F9Q|A Chain A, Crystal Structure Of Human Cytochrome P450 2d6 Length = 479 Back     alignment and structure
>pdb|3QM4|A Chain A, Human Cytochrome P450 (Cyp) 2d6 - Prinomastat Complex Length = 479 Back     alignment and structure
>pdb|3RUK|A Chain A, Human Cytochrome P450 Cyp17a1 In Complex With Abiraterone Length = 494 Back     alignment and structure
>pdb|4GQS|A Chain A, Structure Of Human Microsomal Cytochrome P450 (cyp) 2c19 Length = 477 Back     alignment and structure
>pdb|1DT6|A Chain A, Structure Of Mammalian Cytochrome P450 2c5 Length = 473 Back     alignment and structure
>pdb|1R9O|A Chain A, Crystal Structure Of P4502c9 With Flurbiprofen Bound Length = 477 Back     alignment and structure
>pdb|1OG2|A Chain A, Structure Of Human Cytochrome P450 Cyp2c9 Length = 475 Back     alignment and structure
>pdb|2HI4|A Chain A, Crystal Structure Of Human Microsomal P450 1a2 In Complex With Alpha-Naphthoflavone Length = 495 Back     alignment and structure
>pdb|4I8V|A Chain A, Human Cytochrome P450 1a1 In Complex With Alpha-naphthoflavone Length = 491 Back     alignment and structure
>pdb|2VE3|A Chain A, Retinoic Acid Bound Cyanobacterial Cyp120a1 Length = 444 Back     alignment and structure
>pdb|3HF2|A Chain A, Crystal Structure Of The I401p Mutant Of Cytochrome P450 Bm3 Length = 482 Back     alignment and structure
>pdb|3MZS|A Chain A, Crystal Structure Of Cytochrome P450 Cyp11a1 In Complex With 22- Hydroxy-Cholesterol Length = 486 Back     alignment and structure
>pdb|4DVQ|A Chain A, Structure Of Human Aldosterone Synthase, Cyp11b2, In Complex With Deoxycorticosterone Length = 483 Back     alignment and structure
>pdb|1PQ2|A Chain A, Crystal Structure Of Human Drug Metabolizing Cytochrome P450 2c8 Length = 476 Back     alignment and structure
>pdb|3IBD|A Chain A, Crystal Structure Of A Cytochrome P450 2b6 Genetic Variant In Complex With The Inhibitor 4-(4-Chlorophenyl)imidazole Length = 476 Back     alignment and structure
>pdb|3KX4|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|3QI8|B Chain B, Evolved Variant Of Cytochrome P450 (Bm3, Cyp102a1) Length = 472 Back     alignment and structure
>pdb|3QZ1|A Chain A, Crystal Structure Of Bovine Steroid Of 21-Hydroxylase (P450c21) Length = 496 Back     alignment and structure
>pdb|4DU2|B Chain B, Cytochrome P450 Bm3h-B7 Mri Sensor Bound To Dopamine Length = 470 Back     alignment and structure
>pdb|2NNB|A Chain A, The Q403k Mutnat Heme Domain Of Flavocytochrome P450 Bm3 Length = 471 Back     alignment and structure
>pdb|3EKB|A Chain A, Crystal Structure Of The A264c Mutant Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|2IJ3|A Chain A, Structure Of The A264h Mutant Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|3KX3|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|3EKD|A Chain A, Crystal Structure Of The A264m Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|3M4V|A Chain A, Crystal Structure Of The A330p Mutant Of Cytochrome P450 Bm3 Length = 482 Back     alignment and structure
>pdb|2IJ2|A Chain A, Atomic Structure Of The Heme Domain Of Flavocytochrome P450- Bm3 Length = 470 Back     alignment and structure
>pdb|1SMI|A Chain A, A Single Mutation Of P450 Bm3 Induces The Conformational Rearrangement Seen Upon Substrate-Binding In Wild-Type Enzyme Length = 471 Back     alignment and structure
>pdb|3KX5|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|3E4E|A Chain A, Human Cytochrome P450 2e1 In Complex With The Inhibitor 4- Methylpyrazole Length = 476 Back     alignment and structure
>pdb|3EKF|A Chain A, Crystal Structure Of The A264q Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|3BEN|A Chain A, Structure Of N-(12-Imidazolyl-Dodecanoyl)-L-Leucine Inhibitor Bound To The Heme Domain Of Cytochrome P450-Bm3 Length = 470 Back     alignment and structure
>pdb|1JPZ|A Chain A, Crystal Structure Of A Complex Of The Heme Domain Of P450bm- 3 With N-Palmitoylglycine Length = 473 Back     alignment and structure
>pdb|2IJ4|A Chain A, Structure Of The A264k Mutant Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|2HPD|A Chain A, Crystal Structure Of Hemoprotein Domain Of P450bm-3, A Prototype For Microsomal P450's Length = 471 Back     alignment and structure
>pdb|4DTW|B Chain B, Cytochrome P450 Bm3h-8c8 Mri Sensor Bound To Serotonin Length = 469 Back     alignment and structure
>pdb|3NPL|A Chain A, Structure Of Ru(Bpy)2(A-Phen)(K97c) P450 Bm3 Heme Domain, A Ruthenium Modified P450 Bm3 Mutant Length = 470 Back     alignment and structure
>pdb|1ZO4|A Chain A, Crystal Structure Of A328s Mutant Of The Heme Domain Of P450bm-3 Length = 473 Back     alignment and structure
>pdb|1ZOA|A Chain A, Crystal Structure Of A328v Mutant Of The Heme Domain Of P450bm-3 With N-Palmitoylglycine Length = 473 Back     alignment and structure
>pdb|1FAH|A Chain A, Structure Of Cytochrome P450 Length = 471 Back     alignment and structure
>pdb|3PM0|A Chain A, Structural Characterization Of The Complex Between Alpha- Naphthoflavone And Human Cytochrome P450 1b1 (Cyp1b1) Length = 507 Back     alignment and structure
>pdb|3PSX|A Chain A, Crystal Structure Of The Kt2 Mutant Of Cytochrome P450 Bm3 Length = 487 Back     alignment and structure
>pdb|2X7Y|A Chain A, P450 Bm3 F87a In Complex With Dmso Length = 455 Back     alignment and structure
>pdb|1YQP|A Chain A, T268n Mutant Cytochrome Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|3DGI|A Chain A, Crystal Structure Of F87aT268A MUTANT OF CYP BM3 Length = 461 Back     alignment and structure
>pdb|1YQO|A Chain A, T268a Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|2BMH|A Chain A, Modeling Protein-Substrate Interactions In The Heme Domain Of Cytochrome P450bm-3 Length = 455 Back     alignment and structure
>pdb|2UWH|A Chain A, Cytochrome P450 Bm3 Mutant In Complex With Palmitic Acid Length = 458 Back     alignment and structure
>pdb|1BVY|A Chain A, Complex Of The Heme And Fmn-Binding Domains Of The Cytochrome P450(Bm-3) Length = 458 Back     alignment and structure
>pdb|4DUF|A Chain A, Cytochrome P450 Bm3h-2g9 Mri Sensor Bound To Serotonin Length = 471 Back     alignment and structure
>pdb|4DUC|A Chain A, Cytochrome P450 Bm3h-2g9 Mri Sensor, No Ligand Length = 472 Back     alignment and structure
>pdb|4DUD|A Chain A, Cytochrome P450 Bm3h-2g9c6 Mri Sensor, No Ligand Length = 471 Back     alignment and structure
>pdb|4DUB|A Chain A, Cytochrome P450 Bm3h-9d7 Mri Sensor Bound To Dopamine Length = 472 Back     alignment and structure
>pdb|4DUA|A Chain A, Cytochrome P450 Bm3h-9d7 Mri Sensor, No Ligand Length = 471 Back     alignment and structure
>pdb|3CBD|A Chain A, Directed Evolution Of Cytochrome P450 Bm3, To Octane Monoxygenase 139-3 Length = 455 Back     alignment and structure
>pdb|2P85|A Chain A, Structure Of Human Lung Cytochrome P450 2a13 With Indole Bound In Two Alternate Conformations Length = 476 Back     alignment and structure
>pdb|1P0X|A Chain A, F393y Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|3N9Y|A Chain A, Crystal Structure Of Human Cyp11a1 In Complex With Cholesterol Length = 487 Back     alignment and structure
>pdb|3NA0|A Chain A, Crystal Structure Of Human Cyp11a1 In Complex With 20,22- Dihydroxycholesterol Length = 471 Back     alignment and structure
>pdb|1IZO|A Chain A, Cytochrome P450 Bs Beta Complexed With Fatty Acid Length = 417 Back     alignment and structure
>pdb|1P0W|A Chain A, F393w Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|1JME|A Chain A, Crystal Structure Of Phe393his Cytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|1P0V|A Chain A, F393a Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|3TK3|A Chain A, Cytochrome P450 2b4 Mutant L437a In Complex With 4-(4-Chlorophenyl) Imidazole Length = 476 Back     alignment and structure
>pdb|1PO5|A Chain A, Structure Of Mammalian Cytochrome P450 2b4 Length = 476 Back     alignment and structure
>pdb|4H1N|A Chain A, Crystal Structure Of P450 2b4 F297a Mutant In Complex With Anti- Platelet Drug Clopidogrel Length = 479 Back     alignment and structure
>pdb|2Q6N|A Chain A, Structure Of Cytochrome P450 2b4 With Bound 1-(4- Cholorophenyl)imidazole Length = 478 Back     alignment and structure
>pdb|1SUO|A Chain A, Structure Of Mammalian Cytochrome P450 2b4 With Bound 4-(4- Chlorophenyl)imidazole Length = 476 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query136
3b98_A475 Prostaglandin I2 synthase; prostacyclin synthase, 2e-47
3n9y_A487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 3e-46
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 4e-40
3dax_A491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 8e-39
3awm_A415 Fatty acid alpha-hydroxylase; cytochrome P450, per 1e-28
2cib_A455 Cytochrome P450 51; heme, heme lipid synthesis, me 1e-27
1izo_A417 P450bsbeta, cytochrome P450 152A1; heme protein, p 1e-27
3b6h_A498 Prostacyclin synthase; enzyme-inhibitor complex, C 2e-27
3qz1_A496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 8e-23
3s79_A503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 3e-20
2hi4_A495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 1e-19
3i3k_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 1e-19
2ve3_A444 Putative cytochrome P450 120; oxidoreductase, mono 1e-19
3pm0_A507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 3e-19
3tbg_A479 Cytochrome P450 2D6; monooxygenase, thioridazine, 4e-19
3czh_A481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 5e-19
3dbg_A467 Putative cytochrome P450; cytochrome P450 oxidored 2e-18
3swz_A494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 3e-18
3e6i_A476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 1e-17
2fdv_A476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 2e-17
3gw9_A450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 3e-17
1po5_A476 Cytochrome P450 2B4; oxidoreductase, membrane prot 3e-17
1r9o_A477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 4e-17
3mdm_A456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 3e-14
1n97_A389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 1e-13
3nxu_A485 Cytochrome P450 3A4; alpha beta protein, cytochrom 2e-13
3dan_A473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 1e-11
3dsk_A495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 2e-11
2ij2_A470 Cytochrome P450 BM3; monoxygenase, heme binding pr 3e-10
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Length = 475 Back     alignment and structure
 Score =  157 bits (400), Expect = 2e-47
 Identities = 24/142 (16%), Positives = 46/142 (32%), Gaps = 15/142 (10%)

Query: 2   LLPRQTISHCKI-----NGYDVYPETLLQVNVW-AIGRDSRYWSKAEEFFPERFIDNSVD 55
           L+ R      KI       Y +     L V  + +   D +   + E F  +RF++    
Sbjct: 327 LITRDVTQDKKICLSNGQEYHLRRGDRLCVFPFISPQMDPQIHQQPEMFQFDRFLNADRT 386

Query: 56  FKGQ--------NFELLPFGGGRRICPGIQMGISTVELALTNLLYHFNWKLPNGMEGGDL 107
            K           +  +P+G    +CPG    +  ++  +  +L  F+ +L +      L
Sbjct: 387 EKKDFFKNGARVKYPSVPWGTEDNLCPGRHFAVHAIKELVFTILTRFDVELCDKNATVPL 446

Query: 108 NMEEAIGQSLTTSKKTPLMLVP 129
                 G          L +  
Sbjct: 447 VDPSRYG-FGILQPAGDLEIRY 467
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Length = 491 Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Length = 415 Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Length = 455 Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Length = 417 Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Length = 498 Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Length = 496 Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* Length = 503 Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Length = 495 Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Length = 444 Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Length = 507 Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Length = 479 Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Length = 481 Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Length = 467 Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Length = 494 Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Length = 476 Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Length = 476 Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Length = 450 Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Length = 476 Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Length = 477 Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* Length = 456 Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Length = 389 Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Length = 485 Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Length = 473 Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Length = 495 Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Length = 470 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query136
3tbg_A479 Cytochrome P450 2D6; monooxygenase, thioridazine, 100.0
3n9y_A487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 99.97
3ld6_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 99.97
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 99.97
3nxu_A485 Cytochrome P450 3A4; alpha beta protein, cytochrom 99.97
1po5_A476 Cytochrome P450 2B4; oxidoreductase, membrane prot 99.97
2ve3_A444 Putative cytochrome P450 120; oxidoreductase, mono 99.97
1r9o_A477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 99.97
3mdm_A456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 99.97
2fdv_A476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 99.97
3b98_A475 Prostaglandin I2 synthase; prostacyclin synthase, 99.97
3qz1_A496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 99.97
3pm0_A507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 99.97
3dax_A491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 99.97
3e6i_A476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 99.97
3swz_A494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 99.97
3czh_A481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 99.97
2hi4_A495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 99.97
2cib_A455 Cytochrome P450 51; heme, heme lipid synthesis, me 99.97
3b6h_A498 Prostacyclin synthase; enzyme-inhibitor complex, C 99.96
3s79_A503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 99.96
1izo_A417 P450bsbeta, cytochrome P450 152A1; heme protein, p 99.96
3gw9_A450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 99.96
3i3k_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 99.96
1n97_A389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 99.96
3v8d_A491 Cholesterol 7-alpha-monooxygenase; cytochrome, oxi 99.96
3dbg_A467 Putative cytochrome P450; cytochrome P450 oxidored 99.96
3ejb_B404 Biotin biosynthesis cytochrome P450-like enzyme; p 99.95
3a4g_A411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 99.95
2dkk_A411 Cytochrome P450; CYP158A1, INHI oxidoreductase; HE 99.95
3aba_A403 Cytochrome P450; oxidoreductase, heme, monooxygena 99.95
2ij2_A470 Cytochrome P450 BM3; monoxygenase, heme binding pr 99.95
3buj_A397 CALO2; heme, iron, metal-binding, monooxygenase, o 99.95
3nc3_A441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 99.95
4fb2_A398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 99.95
1ued_A406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 99.95
3awm_A415 Fatty acid alpha-hydroxylase; cytochrome P450, per 99.95
1gwi_A411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 99.95
2cd8_A436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 99.95
4dnj_A412 Putative cytochrome P450; oxidoreductase; HET: HEM 99.95
1n40_A396 P450 MT2, cytochrome P450 121; heme binding, oxyge 99.95
3abb_A408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 99.95
1odo_A408 Putative cytochrome P450 154A1; P450 monooxygenase 99.95
1s1f_A406 Putative cytochrome P450; cytochrome P450 oxidored 99.95
1q5d_A419 P450 epoxidase; cytochrome P450, epothilone, oxydo 99.95
1jfb_A404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 99.95
2uuq_A414 CYP130, cytochrome P450 130; iron, heme, monooxyge 99.95
3oft_A396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 99.95
2xkr_A398 CYP142, putative cytochrome P450 142; oxidoreducta 99.95
2jjn_A411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 99.95
1lfk_A398 OXYB, P450 monooxygenase; oxidative phenol couplin 99.95
3lxh_A421 Cytochrome P450; heme, iron, metal-binding, monoox 99.95
2y5n_A417 MYCG, P-450-like protein; oxidoreductase, mycinami 99.95
2z3t_A425 Cytochrome P450; monoxygenase, oxydoreductase, hem 99.94
1z8o_A404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 99.94
1cpt_A428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 99.94
2xbk_A404 PIMD protein; epoxidation, oxidoreductase; HET: HE 99.94
2zbx_A412 Cytochrome P450-SU1; beta prism, heme, iron, metal 99.94
3mgx_A415 Putative P450 monooxygenase; cytochrome P450 oxida 99.94
3b4x_A367 367AA long hypothetical cytochrome P450; HEM prote 99.94
1io7_A368 Cytochrome P450 CYP119; thermophilic, cytochromo P 99.94
2zwu_A415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 99.94
2z36_A413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 99.94
3ivy_A433 Cytochrome P450 CYP125; cholesterol, monooxygenase 99.94
3rwl_A426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 99.94
2rfb_A343 Cytochrome P450; heme, iron, metal-binding, monoox 99.94
3tyw_A417 Putative cytochrome P450; P450 monooxygenase, oxid 99.94
2wiy_A394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 99.94
3r9b_A418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 99.94
4dxy_A417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 99.93
3tkt_A450 Cytochrome P450; aromatic hydrocarbon binding of P 99.93
2wm5_A435 CYP124, putative cytochrome P450 124; metal-bindin 99.93
3p3o_A416 Cytochrome P450; monooxygenase, oxidoreductase; HE 99.93
3dan_A473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 99.92
3oo3_A384 OXY protein; cytochrome P450, monooxygenase, PCD-t 99.91
2yjn_B381 Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; 99.91
3dsk_A495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 99.9
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Back     alignment and structure
Probab=100.00  E-value=1.3e-33  Score=215.78  Aligned_cols=127  Identities=27%  Similarity=0.466  Sum_probs=104.5

Q ss_pred             CcceeecCCeEEcCEEeCCCCEEEEeehhhccCCCCCCCCCCccCCCcCCCCcCCCCCccceeecCCCCCCCcChHHHHH
Q 032650            2 LLPRQTISHCKINGYDVYPETLLQVNVWAIGRDSRYWSKAEEFFPERFIDNSVDFKGQNFELLPFGGGRRICPGIQMGIS   81 (136)
Q Consensus         2 ~i~R~~~~d~~l~g~~ip~g~~v~~~~~~~~~d~~~~~~p~~f~p~R~~~~~~~~~~~~~~~~~fg~G~r~C~G~~~a~~   81 (136)
                      .++|.+.+|++++||.||+||.|.++.+++|+||++|+||++|+||||++++... ..+..++|||+|+|.|+|++||++
T Consensus       351 ~~~~~~~~d~~~~g~~IP~Gt~V~~~~~~~h~d~~~~~dP~~F~PeRfl~~~~~~-~~~~~~~pFG~G~R~C~G~~lA~~  429 (479)
T 3tbg_A          351 GVTHMTSRDIEVQGFRIPKGTTLITNLSSVLKDEAVWEKPFRFHPEHFLDAQGHF-VKPEAFLPFSAGRRACLGEPLARM  429 (479)
T ss_dssp             CCCEECSSCEEETTEEECTTCEEEEEHHHHHTCTTTSSSTTSCCGGGGBCTTCCB-CCCTTCCTTCCSTTSCTTHHHHHH
T ss_pred             cceeecCCCceECCEEecCCCeeeechhhhcCChhhCCCccccCccccCCCCccc-CCCCceecCCCCCcCChhHHHHHH
Confidence            3566788999999999999999999999999999999999999999999865433 355679999999999999999999


Q ss_pred             HHHHHHHHHHHhceeecCCCCCCCCCCcccccCceeeeccCCCeEEEeecCCC
Q 032650           82 TVELALTNLLYHFNWKLPNGMEGGDLNMEEAIGQSLTTSKKTPLMLVPINYSH  134 (136)
Q Consensus        82 ~~~~~l~~ll~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~r~~  134 (136)
                      |++++++.||++|+|++++++..  .......+  +++.|. ++.|++++|.+
T Consensus       430 e~~~~la~ll~~f~~~~~~~~~~--~~~~~~~~--~~~~P~-~~~v~~~pRs~  477 (479)
T 3tbg_A          430 ELFLFFTSLLQHFSFSVPTGQPR--PSHHGVFA--FLVSPS-PYELCAVPRHH  477 (479)
T ss_dssp             HHHHHHHHHHHHEEEECCTTSCC--CCSCEEES--SSEEEC-CCCBEEEEC--
T ss_pred             HHHHHHHHHHHccEEEeCCCCCC--ccccccce--eeecCC-CeEEEEEECCC
Confidence            99999999999999999877532  22223334  455554 67888888864
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Back     alignment and structure
>3ld6_A Lanosterol 14-alpha demethylase; cytochrome P450, ketoconazole, S genomics, structural genomics consortium, SGC; HET: HEM KKK BCD; 2.80A {Homo sapiens} PDB: 3juv_A* 3jus_A* Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* 4enh_A* 4fia_A* Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* 4gl5_A* 4gl7_A* Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3tik_A* 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Back     alignment and structure
>3v8d_A Cholesterol 7-alpha-monooxygenase; cytochrome, oxidoreductase; HET: HEM 0GV; 1.90A {Homo sapiens} PDB: 3sn5_A* 3dax_A* Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} SCOP: a.104.1.0 PDB: 3ejd_B* 3eje_B* Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Back     alignment and structure
>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 4fmx_A* 4fyz_A* 1t2b_A* 3bdz_A* 3be0_A* Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} SCOP: a.104.1.0 PDB: 3lxi_A* Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} PDB: 4fxb_A* Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Back     alignment and structure
>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} SCOP: a.104.1.0 PDB: 3o1a_A* Back     alignment and structure
>2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 136
d1po5a_465 a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabb 7e-26
d3czha1463 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2 8e-26
d1tqna_472 a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Huma 5e-25
d1r9oa_467 a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Huma 2e-24
d2ciba1445 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-stero 1e-19
d2ij2a1453 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus 1e-18
d1izoa_411 a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Ba 5e-17
d1odoa_401 a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyce 2e-15
d1cpta_428 a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas s 2e-14
d1z8oa1402 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharo 9e-14
d1jfba_399 a.104.1.1 (A:) Cytochrome P450-NOR, nitric reducta 1e-13
d1lfka_394 a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatops 4e-13
d1n97a_385 a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [Tax 1e-12
d1ueda_403 a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatops 3e-12
d1s1fa_399 a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [ 2e-11
d1ue8a_367 a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodai 3e-11
d1q5da_401 a.104.1.1 (A:) Cytochrome P450epok {Sorangium cell 5e-11
d1gwia_403 a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyce 4e-10
d1re9a_404 a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas pu 1e-09
d1n40a_395 a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {My 1e-09
d1io7a_366 a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfata 2e-08
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 465 Back     information, alignment and structure

class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Mammalian cytochrome p450 2b4
species: Rabbit (Oryctolagus cuniculus) [TaxId: 9986]

 Score = 99.0 bits (245), Expect = 7e-26
 Identities = 27/129 (20%), Positives = 50/129 (38%), Gaps = 3/129 (2%)

Query: 1   MLLPRQTISHCKINGYDVYPETLLQVNVWAIGRDSRYWSKAEEFFPERFIDNSVDFKGQN 60
             +P       +  GY +   T +   + +   D RY+     F P  F+D +   K +N
Sbjct: 338 FGVPHTVTKDTQFRGYVIPKNTEVFPVLSSALHDPRYFETPNTFNPGHFLDANGALK-RN 396

Query: 61  FELLPFGGGRRICPGIQMGISTVELALTNLLYHFNWKLPNGMEGGDLNMEEAIGQSLTTS 120
              +PF  G+RIC G  +  + + L  T +L +F+   P   E  D+++           
Sbjct: 397 EGFMPFSLGKRICLGEGIARTELFLFFTTILQNFSIASPVPPE--DIDLTPRESGVGNVP 454

Query: 121 KKTPLMLVP 129
               +  + 
Sbjct: 455 PSYQIRFLA 463
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 463 Back     information, alignment and structure
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Length = 472 Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Length = 467 Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 445 Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Length = 453 Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Length = 411 Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 401 Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Length = 428 Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Length = 402 Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Length = 399 Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Length = 394 Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Length = 385 Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Length = 403 Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Length = 399 Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Length = 367 Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Length = 401 Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 403 Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Length = 404 Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 395 Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 366 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query136
d1tqna_472 Mammalian cytochrome P450 3a4 {Human (Homo sapiens 100.0
d3czha1463 Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapie 99.98
d1po5a_465 Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus 99.97
d2ciba1445 Cytochrome p450 14 alpha-sterol demethylase (cyp51 99.97
d1r9oa_467 Mammalian cytochrome p450 2c9 {Human (Homo sapiens 99.97
d1izoa_411 Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis 99.97
d2ij2a1453 Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 99.96
d1cpta_428 Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306] 99.95
d1odoa_401 Cyp154a1 monooxygenase {Streptomyces coelicolor [T 99.95
d1n97a_385 Cyp175a1 {Thermus thermophilus [TaxId: 274]} 99.95
d1s1fa_399 Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} 99.95
d1q5da_401 Cytochrome P450epok {Sorangium cellulosum [TaxId: 99.95
d1z8oa1402 Cytochrome P450-ERYF {Saccharopolyspora erythraea 99.94
d1gwia_403 Cyp154c1 monooxygenase {Streptomyces coelicolor [T 99.94
d1jfba_399 Cytochrome P450-NOR, nitric reductase {Fungus (Fus 99.94
d1ueda_403 p450 monoxygenase OxyC {Amycolatopsis orientalis [ 99.94
d1lfka_394 p450 monoxygenase OxyB {Amycolatopsis orientalis [ 99.93
d1ue8a_367 Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 11195 99.93
d1io7a_366 Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2 99.93
d1n40a_395 Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tub 99.93
d1re9a_404 Cytochrome P450-CAM {Pseudomonas putida [TaxId: 30 99.92
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Mammalian cytochrome P450 3a4
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=4.2e-33  Score=209.90  Aligned_cols=126  Identities=26%  Similarity=0.508  Sum_probs=109.9

Q ss_pred             CcceeecCCeEEcCEEeCCCCEEEEeehhhccCCCCCCCCCCccCCCcCCCCcCCCCCccceeecCCCCCCCcChHHHHH
Q 032650            2 LLPRQTISHCKINGYDVYPETLLQVNVWAIGRDSRYWSKAEEFFPERFIDNSVDFKGQNFELLPFGGGRRICPGIQMGIS   81 (136)
Q Consensus         2 ~i~R~~~~d~~l~g~~ip~g~~v~~~~~~~~~d~~~~~~p~~f~p~R~~~~~~~~~~~~~~~~~fg~G~r~C~G~~~a~~   81 (136)
                      .++|.+.+|+.++||.||||+.|+++.+++|+||++|+||++|+||||++.+... ..+..++|||+|+|.|+|+++|.+
T Consensus       345 ~~~r~~~~d~~~~g~~ipkGt~v~~~~~~~~~d~~~~~dp~~F~PeRfl~~~~~~-~~~~~~~~FG~G~r~C~G~~~A~~  423 (472)
T d1tqna_         345 RLERVCKKDVEINGMFIPKGVVVMIPSYALHRDPKYWTEPEKFLPERFSKKNKDN-IDPYIYTPFGSGPRNCIGMRFALM  423 (472)
T ss_dssp             CEEEECCSCEEETTEEECTTCEEEECHHHHHTCTTTSSSTTSCCGGGGSTTTGGG-CCTTTSCTTCCSTTSCTTHHHHHH
T ss_pred             ccccccccCccccCceeCCCCEEEEechhhhcCchhCCCccccCccccCCCCccc-CCCceecCCCCCCccChhHHHHHH
Confidence            4679999999999999999999999999999999999999999999999865432 255679999999999999999999


Q ss_pred             HHHHHHHHHHHhceeecCCCCCCCCCCcccccCceeeeccCCCeEEEeecCC
Q 032650           82 TVELALTNLLYHFNWKLPNGMEGGDLNMEEAIGQSLTTSKKTPLMLVPINYS  133 (136)
Q Consensus        82 ~~~~~l~~ll~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~r~  133 (136)
                      +++++++.|+++|+|++.++.+   .+......  .++.|+.++.|++++|.
T Consensus       424 ~~~~~la~ll~~f~~~~~~~~~---~~~~~~~~--~~~~p~~~~~~~~~~R~  470 (472)
T d1tqna_         424 NMKLALIRVLQNFSFKPCKETQ---IPLKLSLG--GLLQPEKPVVLKVESRD  470 (472)
T ss_dssp             HHHHHHHHHHTTEEEECCTTCC---SSCCBCSS--SSCCBSSCCEEEEEETT
T ss_pred             HHHHHHHHHHHhCEEEeCCCCC---CCceeccc--eEEeeCCCEEEEEEECC
Confidence            9999999999999999877643   23333444  67788889999999996
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure