Citrus Sinensis ID: 032659

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130------
MDAQTARIKKWVILYPVYINSKKTIAEGRRISASKACENPTCIEIADCCQYLKIPHAIEIDKAYPRDFMQRGRVRVMLKREDGTFVNPAISSRKQLMLHVAELVPRHPNRTKKQEPASTSSNAGPSKSGKSGKKKR
ccccccccccEEEEEccccccccccHHccccccccccccccHHHHHHHHHHccccEEEEcccccccccccccEEEEEEEcccccccccccccHHHHHHHHHHHccccccccccccccccccccccccccccccccc
******RIKKWVILYPVYINSKKTIAEGRRISASKACENPTCIEIADCCQYLKIPHAIEIDKAYPRDFMQRGRVRVMLKREDGTFVNPAISSRKQLMLHVAE**********************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDAQTARIKKWVILYPVYINSKKTIAEGRRISASKACENPTCIEIADCCQYLKIPHAIEIDKAYPRDFMQRGRVRVMLKREDGTFVNPAISSRKQLMLHVAELVPRHPNRTKKQEPASTSSNAGPSKSGKSGKKKR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Signal recognition particle 19 kDa protein Signal-recognition-particle assembly, binds directly to 7S RNA and mediates binding of the 54 kDa subunit of the SRP.probableP49964
Signal recognition particle 19 kDa protein Signal-recognition-particle assembly, binds directly to 7S RNA and mediates binding of the 54 kDa subunit of the SRP.probableQ943Z6

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1JID, chain A
Confidence level:very confident
Coverage over the Query: 4-110
View the alignment between query and template
View the model in PyMOL