Citrus Sinensis ID: 032672
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 136 | ||||||
| 297739325 | 223 | unnamed protein product [Vitis vinifera] | 1.0 | 0.609 | 0.838 | 2e-59 | |
| 359485584 | 240 | PREDICTED: transcription factor ILR3-lik | 1.0 | 0.566 | 0.838 | 2e-59 | |
| 297741862 | 225 | unnamed protein product [Vitis vinifera] | 1.0 | 0.604 | 0.764 | 4e-56 | |
| 147785376 | 384 | hypothetical protein VITISV_005283 [Viti | 0.948 | 0.335 | 0.829 | 1e-55 | |
| 359497014 | 232 | PREDICTED: transcription factor ILR3-lik | 1.0 | 0.586 | 0.764 | 2e-55 | |
| 357474833 | 261 | Transcription factor ILR3 [Medicago trun | 1.0 | 0.521 | 0.779 | 1e-54 | |
| 357474831 | 237 | Transcription factor ILR3 [Medicago trun | 1.0 | 0.573 | 0.779 | 1e-54 | |
| 357452673 | 230 | Transcription factor ILR3 [Medicago trun | 1.0 | 0.591 | 0.779 | 9e-54 | |
| 224114243 | 243 | predicted protein [Populus trichocarpa] | 1.0 | 0.559 | 0.705 | 3e-51 | |
| 302398597 | 229 | BHLH domain class transcription factor [ | 1.0 | 0.593 | 0.786 | 8e-51 |
| >gi|297739325|emb|CBI28976.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 233 bits (594), Expect = 2e-59, Method: Compositional matrix adjust.
Identities = 114/136 (83%), Positives = 123/136 (90%)
Query: 1 MLEPGRPPKTDKATILSDVVRMMEQLRTEAQKLKQSTEDLQEKIKELKAEKNELRDEKQR 60
+LEPGRPPKTDKA ILSD VRM+ QLR+EAQKLK+S DLQEKIKELKAEKNELRDEKQR
Sbjct: 88 ILEPGRPPKTDKAAILSDAVRMVTQLRSEAQKLKESNGDLQEKIKELKAEKNELRDEKQR 147
Query: 61 LKADKEKLEQQVKAMSAPSGFLPHPSSMSAAFAAQSQVASNKLVPFIGYPGVAMWQFMPP 120
LKA+KEKLEQQVKA+SA GFLPHPS+M AAFAAQ + NKL+PFIGYP VAMWQFMPP
Sbjct: 148 LKAEKEKLEQQVKAISAQPGFLPHPSAMPAAFAAQGRAPGNKLMPFIGYPSVAMWQFMPP 207
Query: 121 AAVDTSQDHVLRPPVA 136
AAVDTSQDHVLRPPVA
Sbjct: 208 AAVDTSQDHVLRPPVA 223
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|359485584|ref|XP_002274829.2| PREDICTED: transcription factor ILR3-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297741862|emb|CBI33226.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|147785376|emb|CAN70830.1| hypothetical protein VITISV_005283 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359497014|ref|XP_002273184.2| PREDICTED: transcription factor ILR3-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|357474833|ref|XP_003607702.1| Transcription factor ILR3 [Medicago truncatula] gi|355508757|gb|AES89899.1| Transcription factor ILR3 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|357474831|ref|XP_003607701.1| Transcription factor ILR3 [Medicago truncatula] gi|217071746|gb|ACJ84233.1| unknown [Medicago truncatula] gi|355508756|gb|AES89898.1| Transcription factor ILR3 [Medicago truncatula] gi|388493018|gb|AFK34575.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|357452673|ref|XP_003596613.1| Transcription factor ILR3 [Medicago truncatula] gi|217071990|gb|ACJ84355.1| unknown [Medicago truncatula] gi|355485661|gb|AES66864.1| Transcription factor ILR3 [Medicago truncatula] gi|388518489|gb|AFK47306.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|224114243|ref|XP_002316706.1| predicted protein [Populus trichocarpa] gi|222859771|gb|EEE97318.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|302398597|gb|ADL36593.1| BHLH domain class transcription factor [Malus x domestica] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 136 | ||||||
| TAIR|locus:2157538 | 234 | ILR3 "AT5G54680" [Arabidopsis | 1.0 | 0.581 | 0.688 | 1.9e-44 | |
| UNIPROTKB|Q6ZKI8 | 253 | OJ1119_D01.9 "BHLH transcripti | 0.992 | 0.533 | 0.537 | 1.3e-34 | |
| TAIR|locus:2129710 | 283 | bHLH104 "AT4G14410" [Arabidops | 0.933 | 0.448 | 0.518 | 3.8e-30 | |
| UNIPROTKB|Q6ZGM4 | 236 | OJ1442_E05.19 "cDNA clone:006- | 1.0 | 0.576 | 0.517 | 4.9e-30 | |
| TAIR|locus:2086198 | 320 | bHLH34 "AT3G23210" [Arabidopsi | 0.941 | 0.4 | 0.489 | 7.3e-27 | |
| TAIR|locus:2092216 | 337 | bHLH121 "AT3G19860" [Arabidops | 0.610 | 0.246 | 0.420 | 8.2e-12 | |
| UNIPROTKB|Q67U21 | 343 | OSJNBa0065F08.2 "Basic helix-l | 0.507 | 0.201 | 0.485 | 2.4e-11 | |
| TAIR|locus:2135169 | 286 | bHLH11 "AT4G36060" [Arabidopsi | 0.602 | 0.286 | 0.380 | 2.3e-10 | |
| UNIPROTKB|Q60EM5 | 77 | OJ1651_D06.8 "Putative unchara | 0.448 | 0.792 | 0.358 | 7e-06 | |
| UNIPROTKB|Q69V10 | 265 | P0506F02.119 "cDNA clone:J0230 | 0.529 | 0.271 | 0.246 | 7.9e-06 |
| TAIR|locus:2157538 ILR3 "AT5G54680" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 468 (169.8 bits), Expect = 1.9e-44, P = 1.9e-44
Identities = 95/138 (68%), Positives = 103/138 (74%)
Query: 1 MLEPGRPPKTDKATILSDVVRMMEQLRTEAQKLKQSTEDLQEKIKELKAEKNELRDEKQR 60
+LEPG PPKTDKA IL D VRM+ QLR EAQKLK S LQ+KIKELK EKNELRDEKQR
Sbjct: 97 ILEPGNPPKTDKAAILVDAVRMVTQLRGEAQKLKDSNSSLQDKIKELKTEKNELRDEKQR 156
Query: 61 LKADKEKLEQQVKAMSAPS-GFLPHPXXXXXXXXXXXXXX-XNKLVPFIGYPGVAMWQFM 118
LK +KEKLEQQ+KAM+AP F P P NK+VP I YPGVAMWQFM
Sbjct: 157 LKTEKEKLEQQLKAMNAPQPSFFPAPPMMPTAFASAQGQAPGNKMVPIISYPGVAMWQFM 216
Query: 119 PPAAVDTSQDHVLRPPVA 136
PPA+VDTSQDHVLRPPVA
Sbjct: 217 PPASVDTSQDHVLRPPVA 234
|
|
| UNIPROTKB|Q6ZKI8 OJ1119_D01.9 "BHLH transcription factor" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2129710 bHLH104 "AT4G14410" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q6ZGM4 OJ1442_E05.19 "cDNA clone:006-303-B03, full insert sequence" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2086198 bHLH34 "AT3G23210" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2092216 bHLH121 "AT3G19860" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q67U21 OSJNBa0065F08.2 "Basic helix-loop-helix-like protein" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2135169 bHLH11 "AT4G36060" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q60EM5 OJ1651_D06.8 "Putative uncharacterized protein OJ1651_D06.8" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q69V10 P0506F02.119 "cDNA clone:J023068N18, full insert sequence" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 136 | |||
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 4e-05 | |
| TIGR04211 | 198 | TIGR04211, SH3_and_anchor, SH3 domain protein | 5e-05 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 6e-05 | |
| pfam04111 | 356 | pfam04111, APG6, Autophagy protein Apg6 | 8e-05 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 2e-04 | |
| PRK03992 | 389 | PRK03992, PRK03992, proteasome-activating nucleoti | 2e-04 | |
| pfam04977 | 80 | pfam04977, DivIC, Septum formation initiator | 2e-04 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 3e-04 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 3e-04 | |
| COG4026 | 290 | COG4026, COG4026, Uncharacterized protein containi | 3e-04 | |
| PRK02224 | 880 | PRK02224, PRK02224, chromosome segregation protein | 3e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 4e-04 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 4e-04 | |
| PRK05771 | 646 | PRK05771, PRK05771, V-type ATP synthase subunit I; | 4e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 5e-04 | |
| PRK03992 | 389 | PRK03992, PRK03992, proteasome-activating nucleoti | 7e-04 | |
| TIGR04211 | 198 | TIGR04211, SH3_and_anchor, SH3 domain protein | 0.001 | |
| COG4026 | 290 | COG4026, COG4026, Uncharacterized protein containi | 0.001 | |
| smart00338 | 65 | smart00338, BRLZ, basic region leucin zipper | 0.001 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.002 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 0.002 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 0.002 | |
| PRK13729 | 475 | PRK13729, PRK13729, conjugal transfer pilus assemb | 0.002 | |
| PRK00409 | 782 | PRK00409, PRK00409, recombination and DNA strand e | 0.002 | |
| pfam10211 | 189 | pfam10211, Ax_dynein_light, Axonemal dynein light | 0.002 | |
| PRK12705 | 508 | PRK12705, PRK12705, hypothetical protein; Provisio | 0.002 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.003 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 0.003 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 0.003 | |
| PRK00409 | 782 | PRK00409, PRK00409, recombination and DNA strand e | 0.003 | |
| pfam08317 | 321 | pfam08317, Spc7, Spc7 kinetochore protein | 0.003 | |
| pfam13870 | 177 | pfam13870, DUF4201, Domain of unknown function (DU | 0.003 | |
| pfam09798 | 648 | pfam09798, LCD1, DNA damage checkpoint protein | 0.003 | |
| TIGR04211 | 198 | TIGR04211, SH3_and_anchor, SH3 domain protein | 0.004 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 0.004 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 0.004 | |
| TIGR03545 | 555 | TIGR03545, TIGR03545, TIGR03545 family protein | 0.004 | |
| pfam12329 | 74 | pfam12329, TMF_DNA_bd, TATA element modulatory fac | 0.004 | |
| pfam01025 | 165 | pfam01025, GrpE, GrpE | 0.004 | |
| TIGR02894 | 161 | TIGR02894, DNA_bind_RsfA, transcription factor, Rs | 0.004 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 0.004 |
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
Score = 41.6 bits (98), Expect = 4e-05
Identities = 19/59 (32%), Positives = 39/59 (66%)
Query: 16 LSDVVRMMEQLRTEAQKLKQSTEDLQEKIKELKAEKNELRDEKQRLKADKEKLEQQVKA 74
L ++ R +E+L+ E L++ E LQ +++EL+ E EL +E + L+ E+LE+++++
Sbjct: 711 LEELERQLEELKRELAALEEELEQLQSRLEELEEELEELEEELEELQERLEELEEELES 769
|
Length = 1163 |
| >gnl|CDD|234501 TIGR04211, SH3_and_anchor, SH3 domain protein | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|217902 pfam04111, APG6, Autophagy protein Apg6 | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|179699 PRK03992, PRK03992, proteasome-activating nucleotidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|203138 pfam04977, DivIC, Septum formation initiator | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226513 COG4026, COG4026, Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|235600 PRK05771, PRK05771, V-type ATP synthase subunit I; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|179699 PRK03992, PRK03992, proteasome-activating nucleotidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234501 TIGR04211, SH3_and_anchor, SH3 domain protein | Back alignment and domain information |
|---|
| >gnl|CDD|226513 COG4026, COG4026, Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|197664 smart00338, BRLZ, basic region leucin zipper | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|184281 PRK13729, PRK13729, conjugal transfer pilus assembly protein TraB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234750 PRK00409, PRK00409, recombination and DNA strand exchange inhibitor protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|204414 pfam10211, Ax_dynein_light, Axonemal dynein light chain | Back alignment and domain information |
|---|
| >gnl|CDD|237178 PRK12705, PRK12705, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|234750 PRK00409, PRK00409, recombination and DNA strand exchange inhibitor protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|219791 pfam08317, Spc7, Spc7 kinetochore protein | Back alignment and domain information |
|---|
| >gnl|CDD|222426 pfam13870, DUF4201, Domain of unknown function (DUF4201) | Back alignment and domain information |
|---|
| >gnl|CDD|220410 pfam09798, LCD1, DNA damage checkpoint protein | Back alignment and domain information |
|---|
| >gnl|CDD|234501 TIGR04211, SH3_and_anchor, SH3 domain protein | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|234252 TIGR03545, TIGR03545, TIGR03545 family protein | Back alignment and domain information |
|---|
| >gnl|CDD|221533 pfam12329, TMF_DNA_bd, TATA element modulatory factor 1 DNA binding | Back alignment and domain information |
|---|
| >gnl|CDD|216249 pfam01025, GrpE, GrpE | Back alignment and domain information |
|---|
| >gnl|CDD|163064 TIGR02894, DNA_bind_RsfA, transcription factor, RsfA family | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 136 | |||
| PF06005 | 72 | DUF904: Protein of unknown function (DUF904); Inte | 97.59 | |
| PRK15422 | 79 | septal ring assembly protein ZapB; Provisional | 97.59 | |
| TIGR02894 | 161 | DNA_bind_RsfA transcription factor, RsfA family. I | 97.29 | |
| COG3074 | 79 | Uncharacterized protein conserved in bacteria [Fun | 97.2 | |
| PF06005 | 72 | DUF904: Protein of unknown function (DUF904); Inte | 97.11 | |
| PF12325 | 120 | TMF_TATA_bd: TATA element modulatory factor 1 TATA | 96.95 | |
| smart00353 | 53 | HLH helix loop helix domain. | 96.78 | |
| PF07106 | 169 | TBPIP: Tat binding protein 1(TBP-1)-interacting pr | 96.73 | |
| TIGR03752 | 472 | conj_TIGR03752 integrating conjugative element pro | 96.53 | |
| PRK15422 | 79 | septal ring assembly protein ZapB; Provisional | 96.45 | |
| TIGR02449 | 65 | conserved hypothetical protein TIGR02449. Members | 96.28 | |
| cd00083 | 60 | HLH Helix-loop-helix domain, found in specific DNA | 96.25 | |
| PF13870 | 177 | DUF4201: Domain of unknown function (DUF4201) | 96.18 | |
| smart00338 | 65 | BRLZ basic region leucin zipper. | 96.15 | |
| PF00170 | 64 | bZIP_1: bZIP transcription factor cAMP response el | 96.11 | |
| COG4026 | 290 | Uncharacterized protein containing TOPRIM domain, | 96.1 | |
| PF04111 | 314 | APG6: Autophagy protein Apg6; InterPro: IPR007243 | 96.09 | |
| PF06156 | 107 | DUF972: Protein of unknown function (DUF972); Inte | 96.05 | |
| COG3883 | 265 | Uncharacterized protein conserved in bacteria [Fun | 96.0 | |
| PF00010 | 55 | HLH: Helix-loop-helix DNA-binding domain only nucl | 95.96 | |
| PF02183 | 45 | HALZ: Homeobox associated leucine zipper; InterPro | 95.93 | |
| PF07926 | 132 | TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: | 95.93 | |
| PRK10884 | 206 | SH3 domain-containing protein; Provisional | 95.91 | |
| PF04880 | 166 | NUDE_C: NUDE protein, C-terminal conserved region; | 95.79 | |
| KOG2264 | 907 | consensus Exostosin EXT1L [Signal transduction mec | 95.63 | |
| PF10224 | 80 | DUF2205: Predicted coiled-coil protein (DUF2205); | 95.61 | |
| PF12329 | 74 | TMF_DNA_bd: TATA element modulatory factor 1 DNA b | 95.53 | |
| PF00170 | 64 | bZIP_1: bZIP transcription factor cAMP response el | 95.48 | |
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 95.4 | |
| PF02403 | 108 | Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal dom | 95.35 | |
| PF10473 | 140 | CENP-F_leu_zip: Leucine-rich repeats of kinetochor | 95.26 | |
| TIGR02894 | 161 | DNA_bind_RsfA transcription factor, RsfA family. I | 95.21 | |
| PF12325 | 120 | TMF_TATA_bd: TATA element modulatory factor 1 TATA | 95.18 | |
| PF02183 | 45 | HALZ: Homeobox associated leucine zipper; InterPro | 95.17 | |
| COG4026 | 290 | Uncharacterized protein containing TOPRIM domain, | 95.15 | |
| COG3074 | 79 | Uncharacterized protein conserved in bacteria [Fun | 95.15 | |
| PF07106 | 169 | TBPIP: Tat binding protein 1(TBP-1)-interacting pr | 95.1 | |
| PRK13169 | 110 | DNA replication intiation control protein YabA; Re | 95.04 | |
| KOG4005 | 292 | consensus Transcription factor XBP-1 [Transcriptio | 95.03 | |
| COG3883 | 265 | Uncharacterized protein conserved in bacteria [Fun | 94.98 | |
| PRK11637 | 428 | AmiB activator; Provisional | 94.92 | |
| PRK11637 | 428 | AmiB activator; Provisional | 94.79 | |
| PF04977 | 80 | DivIC: Septum formation initiator; InterPro: IPR00 | 94.7 | |
| PF10146 | 230 | zf-C4H2: Zinc finger-containing protein ; InterPro | 94.63 | |
| PF08614 | 194 | ATG16: Autophagy protein 16 (ATG16); InterPro: IPR | 94.63 | |
| PF14197 | 69 | Cep57_CLD_2: Centrosome localisation domain of PPC | 94.63 | |
| PF04977 | 80 | DivIC: Septum formation initiator; InterPro: IPR00 | 94.56 | |
| KOG2391 | 365 | consensus Vacuolar sorting protein/ubiquitin recep | 94.56 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 94.55 | |
| PF04325 | 49 | DUF465: Protein of unknown function (DUF465); Inte | 94.53 | |
| PRK09039 | 343 | hypothetical protein; Validated | 94.52 | |
| PTZ00454 | 398 | 26S protease regulatory subunit 6B-like protein; P | 94.48 | |
| PRK13922 | 276 | rod shape-determining protein MreC; Provisional | 94.45 | |
| PRK10884 | 206 | SH3 domain-containing protein; Provisional | 94.45 | |
| PF11932 | 251 | DUF3450: Protein of unknown function (DUF3450); In | 94.42 | |
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 94.39 | |
| PF14662 | 193 | CCDC155: Coiled-coil region of CCDC155 | 94.37 | |
| COG5570 | 57 | Uncharacterized small protein [Function unknown] | 94.37 | |
| TIGR03752 | 472 | conj_TIGR03752 integrating conjugative element pro | 94.26 | |
| PF03962 | 188 | Mnd1: Mnd1 family; InterPro: IPR005647 This family | 94.25 | |
| PF05667 | 594 | DUF812: Protein of unknown function (DUF812); Inte | 94.23 | |
| PTZ00454 | 398 | 26S protease regulatory subunit 6B-like protein; P | 94.19 | |
| PF15294 | 278 | Leu_zip: Leucine zipper | 94.11 | |
| PF04156 | 191 | IncA: IncA protein; InterPro: IPR007285 Chlamydia | 94.01 | |
| PRK13169 | 110 | DNA replication intiation control protein YabA; Re | 93.99 | |
| PF07989 | 75 | Microtub_assoc: Microtubule associated; InterPro: | 93.93 | |
| PRK13729 | 475 | conjugal transfer pilus assembly protein TraB; Pro | 93.9 | |
| PF14662 | 193 | CCDC155: Coiled-coil region of CCDC155 | 93.86 | |
| smart00338 | 65 | BRLZ basic region leucin zipper. | 93.74 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 93.69 | |
| PF07798 | 177 | DUF1640: Protein of unknown function (DUF1640); In | 93.66 | |
| PF06156 | 107 | DUF972: Protein of unknown function (DUF972); Inte | 93.65 | |
| TIGR02209 | 85 | ftsL_broad cell division protein FtsL. This model | 93.63 | |
| PRK00888 | 105 | ftsB cell division protein FtsB; Reviewed | 93.62 | |
| PF08172 | 248 | CASP_C: CASP C terminal; InterPro: IPR012955 This | 93.6 | |
| PF15070 | 617 | GOLGA2L5: Putative golgin subfamily A member 2-lik | 93.42 | |
| KOG1319 | 229 | consensus bHLHZip transcription factor BIGMAX [Tra | 93.35 | |
| PF09789 | 319 | DUF2353: Uncharacterized coiled-coil protein (DUF2 | 93.35 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 93.32 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 93.28 | |
| PF10234 | 267 | Cluap1: Clusterin-associated protein-1; InterPro: | 93.24 | |
| TIGR00219 | 283 | mreC rod shape-determining protein MreC. MreC (mur | 93.23 | |
| PF06632 | 342 | XRCC4: DNA double-strand break repair and V(D)J re | 93.21 | |
| PF11932 | 251 | DUF3450: Protein of unknown function (DUF3450); In | 93.16 | |
| PRK05771 | 646 | V-type ATP synthase subunit I; Validated | 93.15 | |
| TIGR02209 | 85 | ftsL_broad cell division protein FtsL. This model | 93.06 | |
| PF05529 | 192 | Bap31: B-cell receptor-associated protein 31-like | 93.04 | |
| smart00787 | 312 | Spc7 Spc7 kinetochore protein. This domain is foun | 93.02 | |
| PF14282 | 106 | FlxA: FlxA-like protein | 92.99 | |
| PRK13922 | 276 | rod shape-determining protein MreC; Provisional | 92.94 | |
| PF13851 | 201 | GAS: Growth-arrest specific micro-tubule binding | 92.9 | |
| PF07798 | 177 | DUF1640: Protein of unknown function (DUF1640); In | 92.69 | |
| TIGR02449 | 65 | conserved hypothetical protein TIGR02449. Members | 92.67 | |
| PF10186 | 302 | Atg14: UV radiation resistance protein and autopha | 92.59 | |
| PF11559 | 151 | ADIP: Afadin- and alpha -actinin-Binding; InterPro | 92.58 | |
| PRK13729 | 475 | conjugal transfer pilus assembly protein TraB; Pro | 92.55 | |
| PF13815 | 118 | Dzip-like_N: Iguana/Dzip1-like DAZ-interacting pro | 92.54 | |
| PRK05431 | 425 | seryl-tRNA synthetase; Provisional | 92.54 | |
| PHA03011 | 120 | hypothetical protein; Provisional | 92.45 | |
| PF11559 | 151 | ADIP: Afadin- and alpha -actinin-Binding; InterPro | 92.34 | |
| PF04728 | 56 | LPP: Lipoprotein leucine-zipper; InterPro: IPR0068 | 92.33 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 92.21 | |
| PRK03992 | 389 | proteasome-activating nucleotidase; Provisional | 92.2 | |
| PF02403 | 108 | Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal dom | 92.18 | |
| PF07200 | 150 | Mod_r: Modifier of rudimentary (Mod(r)) protein; I | 92.16 | |
| smart00787 | 312 | Spc7 Spc7 kinetochore protein. This domain is foun | 92.16 | |
| PF15070 | 617 | GOLGA2L5: Putative golgin subfamily A member 2-lik | 92.15 | |
| TIGR00219 | 283 | mreC rod shape-determining protein MreC. MreC (mur | 92.1 | |
| PF07200 | 150 | Mod_r: Modifier of rudimentary (Mod(r)) protein; I | 91.99 | |
| TIGR01554 | 378 | major_cap_HK97 phage major capsid protein, HK97 fa | 91.89 | |
| PF07716 | 54 | bZIP_2: Basic region leucine zipper; InterPro: IPR | 91.86 | |
| KOG4360 | 596 | consensus Uncharacterized coiled coil protein [Fun | 91.83 | |
| PF10186 | 302 | Atg14: UV radiation resistance protein and autopha | 91.82 | |
| PF08826 | 61 | DMPK_coil: DMPK coiled coil domain like; InterPro: | 91.81 | |
| PF04111 | 314 | APG6: Autophagy protein Apg6; InterPro: IPR007243 | 91.76 | |
| PRK09039 | 343 | hypothetical protein; Validated | 91.72 | |
| PF01920 | 106 | Prefoldin_2: Prefoldin subunit; InterPro: IPR00277 | 91.7 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 91.66 | |
| KOG1318 | 411 | consensus Helix loop helix transcription factor EB | 91.58 | |
| PRK11415 | 74 | hypothetical protein; Provisional | 91.56 | |
| cd00632 | 105 | Prefoldin_beta Prefoldin beta; Prefoldin is a hexa | 91.54 | |
| PRK03992 | 389 | proteasome-activating nucleotidase; Provisional | 91.48 | |
| PRK00888 | 105 | ftsB cell division protein FtsB; Reviewed | 91.44 | |
| TIGR02231 | 525 | conserved hypothetical protein. This family consis | 91.35 | |
| PF10211 | 189 | Ax_dynein_light: Axonemal dynein light chain; Inte | 91.34 | |
| KOG4797 | 123 | consensus Transcriptional regulator [Transcription | 91.25 | |
| PF00769 | 246 | ERM: Ezrin/radixin/moesin family; InterPro: IPR011 | 91.23 | |
| PF05837 | 106 | CENP-H: Centromere protein H (CENP-H); InterPro: I | 91.15 | |
| TIGR00414 | 418 | serS seryl-tRNA synthetase. This model represents | 91.08 | |
| PF14282 | 106 | FlxA: FlxA-like protein | 90.94 | |
| PF10473 | 140 | CENP-F_leu_zip: Leucine-rich repeats of kinetochor | 90.94 | |
| COG1340 | 294 | Uncharacterized archaeal coiled-coil protein [Func | 90.93 | |
| KOG1962 | 216 | consensus B-cell receptor-associated protein and r | 90.92 | |
| PRK00409 | 782 | recombination and DNA strand exchange inhibitor pr | 90.75 | |
| PF07926 | 132 | TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: | 90.75 | |
| COG4942 | 420 | Membrane-bound metallopeptidase [Cell division and | 90.7 | |
| COG2433 | 652 | Uncharacterized conserved protein [Function unknow | 90.65 | |
| PF10805 | 106 | DUF2730: Protein of unknown function (DUF2730); In | 90.6 | |
| PF01166 | 59 | TSC22: TSC-22/dip/bun family; InterPro: IPR000580 | 90.58 | |
| PF12718 | 143 | Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 | 90.52 | |
| PF14988 | 206 | DUF4515: Domain of unknown function (DUF4515) | 90.49 | |
| PF09304 | 107 | Cortex-I_coil: Cortexillin I, coiled coil; InterPr | 90.48 | |
| PF07334 | 76 | IFP_35_N: Interferon-induced 35 kDa protein (IFP 3 | 90.41 | |
| PF04156 | 191 | IncA: IncA protein; InterPro: IPR007285 Chlamydia | 90.41 | |
| COG2433 | 652 | Uncharacterized conserved protein [Function unknow | 90.39 | |
| KOG0977 | 546 | consensus Nuclear envelope protein lamin, intermed | 90.38 | |
| PF05008 | 79 | V-SNARE: Vesicle transport v-SNARE protein N-termi | 90.36 | |
| PF06632 | 342 | XRCC4: DNA double-strand break repair and V(D)J re | 90.28 | |
| PF03961 | 451 | DUF342: Protein of unknown function (DUF342); Inte | 90.13 | |
| PF14645 | 116 | Chibby: Chibby family | 89.99 | |
| KOG0250 | 1074 | consensus DNA repair protein RAD18 (SMC family pro | 89.96 | |
| PF10498 | 359 | IFT57: Intra-flagellar transport protein 57 ; Inte | 89.93 | |
| PLN02678 | 448 | seryl-tRNA synthetase | 89.93 | |
| PF13851 | 201 | GAS: Growth-arrest specific micro-tubule binding | 89.88 | |
| PF09789 | 319 | DUF2353: Uncharacterized coiled-coil protein (DUF2 | 89.58 | |
| PF05103 | 131 | DivIVA: DivIVA protein; InterPro: IPR007793 The Ba | 89.49 | |
| PF12709 | 87 | Kinetocho_Slk19: Central kinetochore-associated; I | 89.41 | |
| PF05701 | 522 | WEMBL: Weak chloroplast movement under blue light; | 89.39 | |
| PF14197 | 69 | Cep57_CLD_2: Centrosome localisation domain of PPC | 89.38 | |
| PF04999 | 97 | FtsL: Cell division protein FtsL; InterPro: IPR007 | 89.32 | |
| PRK04325 | 74 | hypothetical protein; Provisional | 89.32 | |
| COG3937 | 108 | Uncharacterized conserved protein [Function unknow | 89.31 | |
| PF03961 | 451 | DUF342: Protein of unknown function (DUF342); Inte | 89.3 | |
| PF12709 | 87 | Kinetocho_Slk19: Central kinetochore-associated; I | 89.19 | |
| PF07716 | 54 | bZIP_2: Basic region leucine zipper; InterPro: IPR | 89.14 | |
| PF10458 | 66 | Val_tRNA-synt_C: Valyl tRNA synthetase tRNA bindin | 89.11 | |
| TIGR01069 | 771 | mutS2 MutS2 family protein. Function of MutS2 is u | 89.1 | |
| PF03962 | 188 | Mnd1: Mnd1 family; InterPro: IPR005647 This family | 89.1 | |
| COG2919 | 117 | Septum formation initiator [Cell division and chro | 89.04 | |
| PF05266 | 190 | DUF724: Protein of unknown function (DUF724); Inte | 88.96 | |
| COG5481 | 67 | Uncharacterized conserved small protein containing | 88.89 | |
| PRK02119 | 73 | hypothetical protein; Provisional | 88.84 | |
| PF06810 | 155 | Phage_GP20: Phage minor structural protein GP20; I | 88.79 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 88.56 | |
| PRK14153 | 194 | heat shock protein GrpE; Provisional | 88.53 | |
| PF05377 | 55 | FlaC_arch: Flagella accessory protein C (FlaC); In | 88.53 | |
| PF00769 | 246 | ERM: Ezrin/radixin/moesin family; InterPro: IPR011 | 88.4 | |
| PF08961 | 243 | DUF1875: Domain of unknown function (DUF1875); Int | 88.21 | |
| KOG2751 | 447 | consensus Beclin-like protein [Signal transduction | 88.19 | |
| PF12329 | 74 | TMF_DNA_bd: TATA element modulatory factor 1 DNA b | 88.18 | |
| TIGR01242 | 364 | 26Sp45 26S proteasome subunit P45 family. Many pro | 88.18 | |
| PRK10803 | 263 | tol-pal system protein YbgF; Provisional | 88.13 | |
| TIGR01069 | 771 | mutS2 MutS2 family protein. Function of MutS2 is u | 88.11 | |
| PRK03918 | 880 | chromosome segregation protein; Provisional | 88.09 | |
| PF10482 | 120 | CtIP_N: Tumour-suppressor protein CtIP N-terminal | 88.04 | |
| PF04102 | 69 | SlyX: SlyX; InterPro: IPR007236 The SlyX protein h | 88.03 | |
| PF10226 | 195 | DUF2216: Uncharacterized conserved proteins (DUF22 | 87.99 | |
| KOG2391 | 365 | consensus Vacuolar sorting protein/ubiquitin recep | 87.96 | |
| PF12808 | 52 | Mto2_bdg: Micro-tubular organiser Mto1 C-term Mto2 | 87.95 | |
| PF13747 | 89 | DUF4164: Domain of unknown function (DUF4164) | 87.94 | |
| PF12777 | 344 | MT: Microtubule-binding stalk of dynein motor; Int | 87.8 | |
| KOG3650 | 120 | consensus Predicted coiled-coil protein [General f | 87.79 | |
| smart00340 | 44 | HALZ homeobox associated leucin zipper. | 87.78 | |
| PF04102 | 69 | SlyX: SlyX; InterPro: IPR007236 The SlyX protein h | 87.78 | |
| PF10146 | 230 | zf-C4H2: Zinc finger-containing protein ; InterPro | 87.74 | |
| PLN02320 | 502 | seryl-tRNA synthetase | 87.64 | |
| PRK14160 | 211 | heat shock protein GrpE; Provisional | 87.56 | |
| PF12777 | 344 | MT: Microtubule-binding stalk of dynein motor; Int | 87.55 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 87.44 | |
| PRK14127 | 109 | cell division protein GpsB; Provisional | 87.43 | |
| PF12718 | 143 | Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 | 87.41 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 87.4 | |
| PRK05431 | 425 | seryl-tRNA synthetase; Provisional | 87.37 | |
| KOG4196 | 135 | consensus bZIP transcription factor MafK [Transcri | 87.33 | |
| PF04999 | 97 | FtsL: Cell division protein FtsL; InterPro: IPR007 | 87.32 | |
| TIGR01242 | 364 | 26Sp45 26S proteasome subunit P45 family. Many pro | 87.31 | |
| PRK04406 | 75 | hypothetical protein; Provisional | 87.24 | |
| COG4467 | 114 | Regulator of replication initiation timing [Replic | 87.23 | |
| COG1340 | 294 | Uncharacterized archaeal coiled-coil protein [Func | 87.21 | |
| PF05529 | 192 | Bap31: B-cell receptor-associated protein 31-like | 87.18 | |
| PF05266 | 190 | DUF724: Protein of unknown function (DUF724); Inte | 87.16 | |
| PF10211 | 189 | Ax_dynein_light: Axonemal dynein light chain; Inte | 87.13 | |
| TIGR03185 | 650 | DNA_S_dndD DNA sulfur modification protein DndD. T | 87.1 | |
| PF04728 | 56 | LPP: Lipoprotein leucine-zipper; InterPro: IPR0068 | 87.06 | |
| KOG0946 | 970 | consensus ER-Golgi vesicle-tethering protein p115 | 86.97 | |
| PF10234 | 267 | Cluap1: Clusterin-associated protein-1; InterPro: | 86.96 | |
| PRK15396 | 78 | murein lipoprotein; Provisional | 86.93 | |
| KOG1962 | 216 | consensus B-cell receptor-associated protein and r | 86.69 | |
| PF13600 | 104 | DUF4140: N-terminal domain of unknown function (DU | 86.69 | |
| PF13815 | 118 | Dzip-like_N: Iguana/Dzip1-like DAZ-interacting pro | 86.63 | |
| PF06103 | 90 | DUF948: Bacterial protein of unknown function (DUF | 86.52 | |
| PRK02119 | 73 | hypothetical protein; Provisional | 86.46 | |
| KOG0977 | 546 | consensus Nuclear envelope protein lamin, intermed | 86.42 | |
| PF07889 | 126 | DUF1664: Protein of unknown function (DUF1664); In | 86.29 | |
| COG4942 | 420 | Membrane-bound metallopeptidase [Cell division and | 86.25 | |
| KOG0995 | 581 | consensus Centromere-associated protein HEC1 [Cell | 86.24 | |
| cd00632 | 105 | Prefoldin_beta Prefoldin beta; Prefoldin is a hexa | 86.2 | |
| PF01166 | 59 | TSC22: TSC-22/dip/bun family; InterPro: IPR000580 | 86.18 | |
| PF04012 | 221 | PspA_IM30: PspA/IM30 family; InterPro: IPR007157 T | 86.05 | |
| PF08172 | 248 | CASP_C: CASP C terminal; InterPro: IPR012955 This | 86.04 | |
| PF07407 | 420 | Seadorna_VP6: Seadornavirus VP6 protein; InterPro: | 85.81 | |
| PF06103 | 90 | DUF948: Bacterial protein of unknown function (DUF | 85.8 | |
| PF10805 | 106 | DUF2730: Protein of unknown function (DUF2730); In | 85.78 | |
| PF04420 | 161 | CHD5: CHD5-like protein; InterPro: IPR007514 Membe | 85.69 | |
| KOG0804 | 493 | consensus Cytoplasmic Zn-finger protein BRAP2 (BRC | 85.62 | |
| PRK00846 | 77 | hypothetical protein; Provisional | 85.5 | |
| PF08647 | 96 | BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR01395 | 85.5 | |
| COG1792 | 284 | MreC Cell shape-determining protein [Cell envelope | 85.5 | |
| PRK00295 | 68 | hypothetical protein; Provisional | 85.45 | |
| PF10883 | 87 | DUF2681: Protein of unknown function (DUF2681); In | 85.41 | |
| KOG0982 | 502 | consensus Centrosomal protein Nuf [Cell cycle cont | 85.41 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 85.38 | |
| PF01763 | 557 | Herpes_UL6: Herpesvirus UL6 like; InterPro: IPR002 | 85.17 | |
| COG2919 | 117 | Septum formation initiator [Cell division and chro | 85.16 | |
| KOG4571 | 294 | consensus Activating transcription factor 4 [Trans | 85.14 | |
| PRK02793 | 72 | phi X174 lysis protein; Provisional | 85.1 | |
| PF09744 | 158 | Jnk-SapK_ap_N: JNK_SAPK-associated protein-1; Inte | 85.09 | |
| COG3879 | 247 | Uncharacterized protein conserved in bacteria [Fun | 85.0 | |
| KOG0250 | 1074 | consensus DNA repair protein RAD18 (SMC family pro | 84.91 | |
| PRK14148 | 195 | heat shock protein GrpE; Provisional | 84.89 | |
| TIGR01834 | 320 | PHA_synth_III_E poly(R)-hydroxyalkanoic acid synth | 84.83 | |
| PRK03947 | 140 | prefoldin subunit alpha; Reviewed | 84.68 | |
| PF06698 | 59 | DUF1192: Protein of unknown function (DUF1192); In | 84.55 | |
| PRK04325 | 74 | hypothetical protein; Provisional | 84.5 | |
| PF04871 | 136 | Uso1_p115_C: Uso1 / p115 like vesicle tethering pr | 84.47 | |
| PF09766 | 355 | FimP: Fms-interacting protein; InterPro: IPR019163 | 84.44 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 84.34 | |
| PF14193 | 83 | DUF4315: Domain of unknown function (DUF4315) | 84.33 | |
| PF02388 | 406 | FemAB: FemAB family; InterPro: IPR003447 The femAB | 84.31 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 84.25 | |
| PF10018 | 188 | Med4: Vitamin-D-receptor interacting Mediator subu | 84.24 | |
| COG5493 | 231 | Uncharacterized conserved protein containing a coi | 84.16 | |
| PF14257 | 262 | DUF4349: Domain of unknown function (DUF4349) | 84.11 | |
| PF13600 | 104 | DUF4140: N-terminal domain of unknown function (DU | 84.1 | |
| PF13870 | 177 | DUF4201: Domain of unknown function (DUF4201) | 84.0 | |
| KOG4348 | 627 | consensus Adaptor protein CMS/SETA [Signal transdu | 83.97 | |
| PF15188 | 85 | CCDC-167: Coiled-coil domain-containing protein 16 | 83.91 | |
| PF05700 | 221 | BCAS2: Breast carcinoma amplified sequence 2 (BCAS | 83.87 | |
| PF06785 | 401 | UPF0242: Uncharacterised protein family (UPF0242); | 83.77 | |
| TIGR00414 | 418 | serS seryl-tRNA synthetase. This model represents | 83.72 | |
| PF04012 | 221 | PspA_IM30: PspA/IM30 family; InterPro: IPR007157 T | 83.68 | |
| TIGR02977 | 219 | phageshock_pspA phage shock protein A. Members of | 83.63 | |
| COG3879 | 247 | Uncharacterized protein conserved in bacteria [Fun | 83.61 | |
| KOG0804 | 493 | consensus Cytoplasmic Zn-finger protein BRAP2 (BRC | 83.57 | |
| PF04136 | 157 | Sec34: Sec34-like family ; InterPro: IPR007265 Sec | 83.29 | |
| PF06657 | 79 | Cep57_MT_bd: Centrosome microtubule-binding domain | 83.24 | |
| PF14931 | 120 | IFT20: Intraflagellar transport complex B, subunit | 83.22 | |
| TIGR02338 | 110 | gimC_beta prefoldin, beta subunit, archaeal. Chape | 83.19 | |
| COG1730 | 145 | GIM5 Predicted prefoldin, molecular chaperone impl | 83.16 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 83.15 | |
| PF03954 | 138 | Lectin_N: Hepatic lectin, N-terminal domain; Inter | 83.0 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 82.94 | |
| cd07429 | 108 | Cby_like Chibby, a nuclear inhibitor of Wnt/beta-c | 82.88 | |
| PF09730 | 717 | BicD: Microtubule-associated protein Bicaudal-D; I | 82.87 | |
| PF14523 | 102 | Syntaxin_2: Syntaxin-like protein; PDB: 2DNX_A. | 82.87 | |
| TIGR01000 | 457 | bacteriocin_acc bacteriocin secretion accessory pr | 82.8 | |
| PRK04406 | 75 | hypothetical protein; Provisional | 82.78 | |
| PLN02678 | 448 | seryl-tRNA synthetase | 82.78 | |
| KOG2264 | 907 | consensus Exostosin EXT1L [Signal transduction mec | 82.5 | |
| KOG4643 | 1195 | consensus Uncharacterized coiled-coil protein [Fun | 82.46 | |
| PF15035 | 182 | Rootletin: Ciliary rootlet component, centrosome c | 82.26 | |
| PF04645 | 181 | DUF603: Protein of unknown function, DUF603; Inter | 82.23 | |
| PF09730 | 717 | BicD: Microtubule-associated protein Bicaudal-D; I | 82.13 | |
| PF05377 | 55 | FlaC_arch: Flagella accessory protein C (FlaC); In | 82.02 | |
| KOG3119 | 269 | consensus Basic region leucine zipper transcriptio | 81.95 | |
| PF08826 | 61 | DMPK_coil: DMPK coiled coil domain like; InterPro: | 81.91 | |
| PF08286 | 118 | Spc24: Spc24 subunit of Ndc80; InterPro: IPR013252 | 81.83 | |
| TIGR00293 | 126 | prefoldin, archaeal alpha subunit/eukaryotic subun | 81.8 | |
| TIGR00634 | 563 | recN DNA repair protein RecN. All proteins in this | 81.72 | |
| PF10779 | 71 | XhlA: Haemolysin XhlA; InterPro: IPR019715 Haemoly | 81.54 | |
| PRK09973 | 85 | putative outer membrane lipoprotein; Provisional | 81.36 | |
| PF10267 | 395 | Tmemb_cc2: Predicted transmembrane and coiled-coil | 81.3 | |
| TIGR03007 | 498 | pepcterm_ChnLen polysaccharide chain length determ | 81.29 | |
| PF15458 | 254 | NTR2: Nineteen complex-related protein 2 | 81.29 | |
| PF05103 | 131 | DivIVA: DivIVA protein; InterPro: IPR007793 The Ba | 81.26 | |
| PRK14127 | 109 | cell division protein GpsB; Provisional | 81.22 | |
| PF12999 | 176 | PRKCSH-like: Glucosidase II beta subunit-like | 81.22 | |
| PF08647 | 96 | BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR01395 | 81.12 | |
| KOG4343 | 655 | consensus bZIP transcription factor ATF6 [Transcri | 81.12 | |
| PF14988 | 206 | DUF4515: Domain of unknown function (DUF4515) | 81.01 | |
| PF13514 | 1111 | AAA_27: AAA domain | 80.99 | |
| KOG3647 | 338 | consensus Predicted coiled-coil protein [General f | 80.96 | |
| PF04822 | 84 | Takusan: Takusan; InterPro: IPR006907 This family | 80.95 | |
| PRK14161 | 178 | heat shock protein GrpE; Provisional | 80.93 | |
| KOG3433 | 203 | consensus Protein involved in meiotic recombinatio | 80.86 | |
| TIGR02680 | 1353 | conserved hypothetical protein TIGR02680. Members | 80.86 | |
| PRK13923 | 170 | putative spore coat protein regulator protein YlbO | 80.78 | |
| PF09755 | 310 | DUF2046: Uncharacterized conserved protein H4 (DUF | 80.67 | |
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 80.57 | |
| PF08738 | 103 | Gon7: Gon7 family; InterPro: IPR014849 In Saccharo | 80.47 | |
| PF12711 | 86 | Kinesin-relat_1: Kinesin motor; InterPro: IPR02465 | 80.45 | |
| COG5509 | 65 | Uncharacterized small protein containing a coiled- | 80.29 | |
| COG2841 | 72 | Uncharacterized protein conserved in bacteria [Fun | 80.25 | |
| PF02050 | 123 | FliJ: Flagellar FliJ protein; InterPro: IPR012823 | 80.23 | |
| PF04849 | 306 | HAP1_N: HAP1 N-terminal conserved region; InterPro | 80.14 | |
| KOG3433 | 203 | consensus Protein involved in meiotic recombinatio | 80.12 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 80.1 | |
| COG5185 | 622 | HEC1 Protein involved in chromosome segregation, i | 80.09 | |
| PF11544 | 76 | Spc42p: Spindle pole body component Spc42p; InterP | 80.03 | |
| PF07047 | 134 | OPA3: Optic atrophy 3 protein (OPA3); InterPro: IP | 80.01 |
| >PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation | Back alignment and domain information |
|---|
Probab=97.59 E-value=0.00092 Score=46.54 Aligned_cols=55 Identities=35% Similarity=0.520 Sum_probs=38.9
Q ss_pred HHHHHHHHHHHHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHh
Q 032672 20 VRMMEQLRTEAQKLKQSTEDLQEKIKELKAEKNELRDEKQRLKADKEKLEQQVKA 74 (136)
Q Consensus 20 ir~lkqLr~e~~~Lk~~n~~L~ee~~~L~~EKnELrdEk~~Lk~eke~Le~qlk~ 74 (136)
+.++.+|-.+|+.+=+.+..|+.++.+|+.+.++|.+++..|+.+-++|.++..+
T Consensus 3 ~E~l~~LE~ki~~aveti~~Lq~e~eeLke~n~~L~~e~~~L~~en~~L~~e~~~ 57 (72)
T PF06005_consen 3 LELLEQLEEKIQQAVETIALLQMENEELKEKNNELKEENEELKEENEQLKQERNA 57 (72)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred hHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHH
Confidence 4677777777777777777777777777777666666666666666666655443
|
It is recruited early to the divisome by direct interaction with FtsZ, stimulating Z-ring assembly and thereby promoting cell division earlier in the cell cycle. Its recruitment to the Z-ring requires functional FtsA or ZipA.; GO: 0000917 barrier septum formation, 0043093 cytokinesis by binary fission, 0005737 cytoplasm; PDB: 2JEE_A. |
| >PRK15422 septal ring assembly protein ZapB; Provisional | Back alignment and domain information |
|---|
| >TIGR02894 DNA_bind_RsfA transcription factor, RsfA family | Back alignment and domain information |
|---|
| >COG3074 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation | Back alignment and domain information |
|---|
| >PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] | Back alignment and domain information |
|---|
| >smart00353 HLH helix loop helix domain | Back alignment and domain information |
|---|
| >PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences | Back alignment and domain information |
|---|
| >TIGR03752 conj_TIGR03752 integrating conjugative element protein, PFL_4705 family | Back alignment and domain information |
|---|
| >PRK15422 septal ring assembly protein ZapB; Provisional | Back alignment and domain information |
|---|
| >TIGR02449 conserved hypothetical protein TIGR02449 | Back alignment and domain information |
|---|
| >cd00083 HLH Helix-loop-helix domain, found in specific DNA- binding proteins that act as transcription factors; 60-100 amino acids long | Back alignment and domain information |
|---|
| >PF13870 DUF4201: Domain of unknown function (DUF4201) | Back alignment and domain information |
|---|
| >smart00338 BRLZ basic region leucin zipper | Back alignment and domain information |
|---|
| >PF00170 bZIP_1: bZIP transcription factor cAMP response element binding (CREB) protein signature fos transforming protein signature jun transcription factor signature; InterPro: IPR011616 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotic are proteins that contain a basic region mediating sequence-specific DNA-binding followed by a leucine zipper region (see IPR002158 from INTERPRO) required for dimerization | Back alignment and domain information |
|---|
| >COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] | Back alignment and domain information |
|---|
| >PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >PF06156 DUF972: Protein of unknown function (DUF972); InterPro: IPR010377 FUNCTION: Involved in initiation control of chromosome replication | Back alignment and domain information |
|---|
| >COG3883 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF00010 HLH: Helix-loop-helix DNA-binding domain only nuclear translocator protein (Arnt) | Back alignment and domain information |
|---|
| >PF02183 HALZ: Homeobox associated leucine zipper; InterPro: IPR003106 This region is a plant specific leucine zipper that is always found associated with a homeobox [] | Back alignment and domain information |
|---|
| >PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) | Back alignment and domain information |
|---|
| >PRK10884 SH3 domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >PF04880 NUDE_C: NUDE protein, C-terminal conserved region; InterPro: IPR006964 This domain represents the C-terminal conserved region of NUDE proteins | Back alignment and domain information |
|---|
| >KOG2264 consensus Exostosin EXT1L [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF10224 DUF2205: Predicted coiled-coil protein (DUF2205); InterPro: IPR019357 This entry represents a highly conserved 100 residue region which is likely to have a coiled-coil structure | Back alignment and domain information |
|---|
| >PF12329 TMF_DNA_bd: TATA element modulatory factor 1 DNA binding; InterPro: IPR022092 This is the middle region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes that contains at its N-terminal section a number of leucine zippers that could potentially form coiled coil structures | Back alignment and domain information |
|---|
| >PF00170 bZIP_1: bZIP transcription factor cAMP response element binding (CREB) protein signature fos transforming protein signature jun transcription factor signature; InterPro: IPR011616 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotic are proteins that contain a basic region mediating sequence-specific DNA-binding followed by a leucine zipper region (see IPR002158 from INTERPRO) required for dimerization | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >PF02403 Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal domain; InterPro: IPR015866 The aminoacyl-tRNA synthetases (6 | Back alignment and domain information |
|---|
| >PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] | Back alignment and domain information |
|---|
| >TIGR02894 DNA_bind_RsfA transcription factor, RsfA family | Back alignment and domain information |
|---|
| >PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] | Back alignment and domain information |
|---|
| >PF02183 HALZ: Homeobox associated leucine zipper; InterPro: IPR003106 This region is a plant specific leucine zipper that is always found associated with a homeobox [] | Back alignment and domain information |
|---|
| >COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] | Back alignment and domain information |
|---|
| >COG3074 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences | Back alignment and domain information |
|---|
| >PRK13169 DNA replication intiation control protein YabA; Reviewed | Back alignment and domain information |
|---|
| >KOG4005 consensus Transcription factor XBP-1 [Transcription] | Back alignment and domain information |
|---|
| >COG3883 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >PF04977 DivIC: Septum formation initiator; InterPro: IPR007060 DivIC, from the spore-forming, Gram-positive bacterium Bacillus subtilis, is necessary for both vegetative and sporulation septum formation [] | Back alignment and domain information |
|---|
| >PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 | Back alignment and domain information |
|---|
| >PF04977 DivIC: Septum formation initiator; InterPro: IPR007060 DivIC, from the spore-forming, Gram-positive bacterium Bacillus subtilis, is necessary for both vegetative and sporulation septum formation [] | Back alignment and domain information |
|---|
| >KOG2391 consensus Vacuolar sorting protein/ubiquitin receptor VPS23 [Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >PF04325 DUF465: Protein of unknown function (DUF465); InterPro: IPR007420 Family members are found in small bacterial proteins, and also in the heavy chains of eukaryotic myosin and kinesin, C-terminal of the motor domain | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK13922 rod shape-determining protein MreC; Provisional | Back alignment and domain information |
|---|
| >PRK10884 SH3 domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >PF14662 CCDC155: Coiled-coil region of CCDC155 | Back alignment and domain information |
|---|
| >COG5570 Uncharacterized small protein [Function unknown] | Back alignment and domain information |
|---|
| >TIGR03752 conj_TIGR03752 integrating conjugative element protein, PFL_4705 family | Back alignment and domain information |
|---|
| >PF03962 Mnd1: Mnd1 family; InterPro: IPR005647 This family of proteins includes meiotic nuclear division protein 1 (MND1) from Saccharomyces cerevisiae (Baker's yeast) | Back alignment and domain information |
|---|
| >PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional | Back alignment and domain information |
|---|
| >PF15294 Leu_zip: Leucine zipper | Back alignment and domain information |
|---|
| >PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion | Back alignment and domain information |
|---|
| >PRK13169 DNA replication intiation control protein YabA; Reviewed | Back alignment and domain information |
|---|
| >PF07989 Microtub_assoc: Microtubule associated; InterPro: IPR012943 Proteins with this domain associate with the spindle body during cell division [] | Back alignment and domain information |
|---|
| >PRK13729 conjugal transfer pilus assembly protein TraB; Provisional | Back alignment and domain information |
|---|
| >PF14662 CCDC155: Coiled-coil region of CCDC155 | Back alignment and domain information |
|---|
| >smart00338 BRLZ basic region leucin zipper | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >PF07798 DUF1640: Protein of unknown function (DUF1640); InterPro: IPR024461 This family consists of uncharacterised proteins | Back alignment and domain information |
|---|
| >PF06156 DUF972: Protein of unknown function (DUF972); InterPro: IPR010377 FUNCTION: Involved in initiation control of chromosome replication | Back alignment and domain information |
|---|
| >TIGR02209 ftsL_broad cell division protein FtsL | Back alignment and domain information |
|---|
| >PRK00888 ftsB cell division protein FtsB; Reviewed | Back alignment and domain information |
|---|
| >PF08172 CASP_C: CASP C terminal; InterPro: IPR012955 This domain is the C-terminal region of the CASP family of proteins | Back alignment and domain information |
|---|
| >PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 | Back alignment and domain information |
|---|
| >KOG1319 consensus bHLHZip transcription factor BIGMAX [Transcription] | Back alignment and domain information |
|---|
| >PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >PF10234 Cluap1: Clusterin-associated protein-1; InterPro: IPR019366 This protein of 413 amino acids contains a central coiled-coil domain, possibly the region that binds to clusterin | Back alignment and domain information |
|---|
| >TIGR00219 mreC rod shape-determining protein MreC | Back alignment and domain information |
|---|
| >PF06632 XRCC4: DNA double-strand break repair and V(D)J recombination protein XRCC4; InterPro: IPR010585 This entry represents the DNA double-strand break repair and V(D)J recombination protein XRCC4, which is found in certain Metazoans, fungi and plants | Back alignment and domain information |
|---|
| >PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function | Back alignment and domain information |
|---|
| >PRK05771 V-type ATP synthase subunit I; Validated | Back alignment and domain information |
|---|
| >TIGR02209 ftsL_broad cell division protein FtsL | Back alignment and domain information |
|---|
| >PF05529 Bap31: B-cell receptor-associated protein 31-like ; InterPro: IPR008417 Bap31 is a polytopic integral protein of the endoplasmic reticulum membrane and a substrate of caspase-8 | Back alignment and domain information |
|---|
| >smart00787 Spc7 Spc7 kinetochore protein | Back alignment and domain information |
|---|
| >PF14282 FlxA: FlxA-like protein | Back alignment and domain information |
|---|
| >PRK13922 rod shape-determining protein MreC; Provisional | Back alignment and domain information |
|---|
| >PF13851 GAS: Growth-arrest specific micro-tubule binding | Back alignment and domain information |
|---|
| >PF07798 DUF1640: Protein of unknown function (DUF1640); InterPro: IPR024461 This family consists of uncharacterised proteins | Back alignment and domain information |
|---|
| >TIGR02449 conserved hypothetical protein TIGR02449 | Back alignment and domain information |
|---|
| >PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking | Back alignment and domain information |
|---|
| >PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch | Back alignment and domain information |
|---|
| >PRK13729 conjugal transfer pilus assembly protein TraB; Provisional | Back alignment and domain information |
|---|
| >PF13815 Dzip-like_N: Iguana/Dzip1-like DAZ-interacting protein N-terminal | Back alignment and domain information |
|---|
| >PRK05431 seryl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >PHA03011 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch | Back alignment and domain information |
|---|
| >PF04728 LPP: Lipoprotein leucine-zipper; InterPro: IPR006817 This repeating sequence, NAKVDQLSNDV, is found in the enterobacterial outer membrane lipoprotein LPP | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >PRK03992 proteasome-activating nucleotidase; Provisional | Back alignment and domain information |
|---|
| >PF02403 Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal domain; InterPro: IPR015866 The aminoacyl-tRNA synthetases (6 | Back alignment and domain information |
|---|
| >PF07200 Mod_r: Modifier of rudimentary (Mod(r)) protein; InterPro: IPR009851 This entry represents a conserved region approximately 150 residues long within a number of eukaryotic proteins that show homology with Drosophila melanogaster Modifier of rudimentary (Mod(r)) proteins | Back alignment and domain information |
|---|
| >smart00787 Spc7 Spc7 kinetochore protein | Back alignment and domain information |
|---|
| >PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 | Back alignment and domain information |
|---|
| >TIGR00219 mreC rod shape-determining protein MreC | Back alignment and domain information |
|---|
| >PF07200 Mod_r: Modifier of rudimentary (Mod(r)) protein; InterPro: IPR009851 This entry represents a conserved region approximately 150 residues long within a number of eukaryotic proteins that show homology with Drosophila melanogaster Modifier of rudimentary (Mod(r)) proteins | Back alignment and domain information |
|---|
| >TIGR01554 major_cap_HK97 phage major capsid protein, HK97 family | Back alignment and domain information |
|---|
| >PF07716 bZIP_2: Basic region leucine zipper; InterPro: IPR011700 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotes are proteins that contain a basic region mediating sequence-specific DNA-binding, followed by a leucine zipper region (see IPR002158 from INTERPRO), which is required for dimerization | Back alignment and domain information |
|---|
| >KOG4360 consensus Uncharacterized coiled coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking | Back alignment and domain information |
|---|
| >PF08826 DMPK_coil: DMPK coiled coil domain like; InterPro: IPR014930 This domain is found in the myotonic dystrophy protein kinase (DMPK) and adopts a coiled coil structure | Back alignment and domain information |
|---|
| >PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF01920 Prefoldin_2: Prefoldin subunit; InterPro: IPR002777 Prefoldin (PFD) is a chaperone that interacts exclusively with type II chaperonins, hetero-oligomers lacking an obligate co-chaperonin that are found only in eukaryotes (chaperonin-containing T-complex polypeptide-1 (CCT)) and archaea | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >KOG1318 consensus Helix loop helix transcription factor EB [Transcription] | Back alignment and domain information |
|---|
| >PRK11415 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd00632 Prefoldin_beta Prefoldin beta; Prefoldin is a hexameric molecular chaperone complex, composed of two evolutionarily related subunits (alpha and beta), which are found in both eukaryotes and archaea | Back alignment and domain information |
|---|
| >PRK03992 proteasome-activating nucleotidase; Provisional | Back alignment and domain information |
|---|
| >PRK00888 ftsB cell division protein FtsB; Reviewed | Back alignment and domain information |
|---|
| >TIGR02231 conserved hypothetical protein | Back alignment and domain information |
|---|
| >PF10211 Ax_dynein_light: Axonemal dynein light chain; InterPro: IPR019347 Axonemal dynein light chain proteins play a dynamic role in flagellar and cilial motility | Back alignment and domain information |
|---|
| >KOG4797 consensus Transcriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] | Back alignment and domain information |
|---|
| >PF05837 CENP-H: Centromere protein H (CENP-H); InterPro: IPR008426 Chromosome segregation in eukaryotes requires the kinetochore, a multi-protein structure that assembles on centromeric DNA, and which acts to link chromosomes to spindle microtubules | Back alignment and domain information |
|---|
| >TIGR00414 serS seryl-tRNA synthetase | Back alignment and domain information |
|---|
| >PF14282 FlxA: FlxA-like protein | Back alignment and domain information |
|---|
| >PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] | Back alignment and domain information |
|---|
| >COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1962 consensus B-cell receptor-associated protein and related proteins [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed | Back alignment and domain information |
|---|
| >PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) | Back alignment and domain information |
|---|
| >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >COG2433 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF10805 DUF2730: Protein of unknown function (DUF2730); InterPro: IPR020269 This entry represents a family of various hypothetical proteins | Back alignment and domain information |
|---|
| >PF01166 TSC22: TSC-22/dip/bun family; InterPro: IPR000580 Several eukaryotic proteins are evolutionary related and are thought to be involved in transcriptional regulation | Back alignment and domain information |
|---|
| >PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >PF14988 DUF4515: Domain of unknown function (DUF4515) | Back alignment and domain information |
|---|
| >PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold) | Back alignment and domain information |
|---|
| >PF07334 IFP_35_N: Interferon-induced 35 kDa protein (IFP 35) N-terminus; InterPro: IPR009938 This entry represents the N terminus of interferon-induced 35 kDa protein (IFP 35) (approximately 80 residues long), which contains a leucine zipper motif in an alpha helical configuration [] | Back alignment and domain information |
|---|
| >PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion | Back alignment and domain information |
|---|
| >COG2433 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] | Back alignment and domain information |
|---|
| >PF05008 V-SNARE: Vesicle transport v-SNARE protein N-terminus; InterPro: IPR007705 V-SNARE proteins are required for protein traffic between eukaryotic organelles | Back alignment and domain information |
|---|
| >PF06632 XRCC4: DNA double-strand break repair and V(D)J recombination protein XRCC4; InterPro: IPR010585 This entry represents the DNA double-strand break repair and V(D)J recombination protein XRCC4, which is found in certain Metazoans, fungi and plants | Back alignment and domain information |
|---|
| >PF03961 DUF342: Protein of unknown function (DUF342); InterPro: IPR005646 This family of bacterial proteins has no known function | Back alignment and domain information |
|---|
| >PF14645 Chibby: Chibby family | Back alignment and domain information |
|---|
| >KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms | Back alignment and domain information |
|---|
| >PLN02678 seryl-tRNA synthetase | Back alignment and domain information |
|---|
| >PF13851 GAS: Growth-arrest specific micro-tubule binding | Back alignment and domain information |
|---|
| >PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function | Back alignment and domain information |
|---|
| >PF05103 DivIVA: DivIVA protein; InterPro: IPR007793 The Bacillus subtilis divIVA1 mutation causes misplacement of the septum during cell division, resulting in the formation of small, circular, anucleate minicells [] | Back alignment and domain information |
|---|
| >PF12709 Kinetocho_Slk19: Central kinetochore-associated; InterPro: IPR024312 This is a family of proteins integrally involved in the central kinetochore | Back alignment and domain information |
|---|
| >PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 | Back alignment and domain information |
|---|
| >PF04999 FtsL: Cell division protein FtsL; InterPro: IPR007082 In Escherichia coli, nine gene products are known to be essential for assembly of the division septum | Back alignment and domain information |
|---|
| >PRK04325 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG3937 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF03961 DUF342: Protein of unknown function (DUF342); InterPro: IPR005646 This family of bacterial proteins has no known function | Back alignment and domain information |
|---|
| >PF12709 Kinetocho_Slk19: Central kinetochore-associated; InterPro: IPR024312 This is a family of proteins integrally involved in the central kinetochore | Back alignment and domain information |
|---|
| >PF07716 bZIP_2: Basic region leucine zipper; InterPro: IPR011700 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotes are proteins that contain a basic region mediating sequence-specific DNA-binding, followed by a leucine zipper region (see IPR002158 from INTERPRO), which is required for dimerization | Back alignment and domain information |
|---|
| >PF10458 Val_tRNA-synt_C: Valyl tRNA synthetase tRNA binding arm; InterPro: IPR019499 The aminoacyl-tRNA synthetases (6 | Back alignment and domain information |
|---|
| >TIGR01069 mutS2 MutS2 family protein | Back alignment and domain information |
|---|
| >PF03962 Mnd1: Mnd1 family; InterPro: IPR005647 This family of proteins includes meiotic nuclear division protein 1 (MND1) from Saccharomyces cerevisiae (Baker's yeast) | Back alignment and domain information |
|---|
| >COG2919 Septum formation initiator [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF05266 DUF724: Protein of unknown function (DUF724); InterPro: IPR007930 This family contains several uncharacterised proteins found exclusively in Arabidopsis thaliana | Back alignment and domain information |
|---|
| >COG5481 Uncharacterized conserved small protein containing a coiled-coil domain [Function unknown] | Back alignment and domain information |
|---|
| >PRK02119 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF06810 Phage_GP20: Phage minor structural protein GP20; InterPro: IPR009636 This family consists of several phage minor structural protein Gp20 sequences and prophage sequences of around 180 residues in length | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >PRK14153 heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >PF05377 FlaC_arch: Flagella accessory protein C (FlaC); InterPro: IPR008039 Although archaeal flagella appear superficially similar to those of bacteria, they are quite distinct [] | Back alignment and domain information |
|---|
| >PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] | Back alignment and domain information |
|---|
| >PF08961 DUF1875: Domain of unknown function (DUF1875); InterPro: IPR015056 MIT can be found in the Nuclear receptor-binding factor 2, it has no known function | Back alignment and domain information |
|---|
| >KOG2751 consensus Beclin-like protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF12329 TMF_DNA_bd: TATA element modulatory factor 1 DNA binding; InterPro: IPR022092 This is the middle region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes that contains at its N-terminal section a number of leucine zippers that could potentially form coiled coil structures | Back alignment and domain information |
|---|
| >TIGR01242 26Sp45 26S proteasome subunit P45 family | Back alignment and domain information |
|---|
| >PRK10803 tol-pal system protein YbgF; Provisional | Back alignment and domain information |
|---|
| >TIGR01069 mutS2 MutS2 family protein | Back alignment and domain information |
|---|
| >PRK03918 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PF10482 CtIP_N: Tumour-suppressor protein CtIP N-terminal domain; InterPro: IPR019518 CtIP is predominantly a nuclear protein that complexes with both BRCA1 and the BRCA1-associated RING domain protein (BARD1) | Back alignment and domain information |
|---|
| >PF04102 SlyX: SlyX; InterPro: IPR007236 The SlyX protein has no known function | Back alignment and domain information |
|---|
| >PF10226 DUF2216: Uncharacterized conserved proteins (DUF2216); InterPro: IPR019359 Proteins in this entry are found in Metazoa and contain a coiled-coil domain | Back alignment and domain information |
|---|
| >KOG2391 consensus Vacuolar sorting protein/ubiquitin receptor VPS23 [Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF12808 Mto2_bdg: Micro-tubular organiser Mto1 C-term Mto2-binding region; InterPro: IPR024545 This domain occurs at the C terminus of microtubule organising proteins in both budding and fission fungi | Back alignment and domain information |
|---|
| >PF13747 DUF4164: Domain of unknown function (DUF4164) | Back alignment and domain information |
|---|
| >PF12777 MT: Microtubule-binding stalk of dynein motor; InterPro: IPR024743 The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases | Back alignment and domain information |
|---|
| >KOG3650 consensus Predicted coiled-coil protein [General function prediction only] | Back alignment and domain information |
|---|
| >smart00340 HALZ homeobox associated leucin zipper | Back alignment and domain information |
|---|
| >PF04102 SlyX: SlyX; InterPro: IPR007236 The SlyX protein has no known function | Back alignment and domain information |
|---|
| >PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PLN02320 seryl-tRNA synthetase | Back alignment and domain information |
|---|
| >PRK14160 heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >PF12777 MT: Microtubule-binding stalk of dynein motor; InterPro: IPR024743 The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14127 cell division protein GpsB; Provisional | Back alignment and domain information |
|---|
| >PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >PRK05431 seryl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >KOG4196 consensus bZIP transcription factor MafK [Transcription] | Back alignment and domain information |
|---|
| >PF04999 FtsL: Cell division protein FtsL; InterPro: IPR007082 In Escherichia coli, nine gene products are known to be essential for assembly of the division septum | Back alignment and domain information |
|---|
| >TIGR01242 26Sp45 26S proteasome subunit P45 family | Back alignment and domain information |
|---|
| >PRK04406 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG4467 Regulator of replication initiation timing [Replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF05529 Bap31: B-cell receptor-associated protein 31-like ; InterPro: IPR008417 Bap31 is a polytopic integral protein of the endoplasmic reticulum membrane and a substrate of caspase-8 | Back alignment and domain information |
|---|
| >PF05266 DUF724: Protein of unknown function (DUF724); InterPro: IPR007930 This family contains several uncharacterised proteins found exclusively in Arabidopsis thaliana | Back alignment and domain information |
|---|
| >PF10211 Ax_dynein_light: Axonemal dynein light chain; InterPro: IPR019347 Axonemal dynein light chain proteins play a dynamic role in flagellar and cilial motility | Back alignment and domain information |
|---|
| >TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
| >PF04728 LPP: Lipoprotein leucine-zipper; InterPro: IPR006817 This repeating sequence, NAKVDQLSNDV, is found in the enterobacterial outer membrane lipoprotein LPP | Back alignment and domain information |
|---|
| >KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF10234 Cluap1: Clusterin-associated protein-1; InterPro: IPR019366 This protein of 413 amino acids contains a central coiled-coil domain, possibly the region that binds to clusterin | Back alignment and domain information |
|---|
| >PRK15396 murein lipoprotein; Provisional | Back alignment and domain information |
|---|
| >KOG1962 consensus B-cell receptor-associated protein and related proteins [Defense mechanisms] | Back alignment and domain information |
|---|
| >PF13600 DUF4140: N-terminal domain of unknown function (DUF4140) | Back alignment and domain information |
|---|
| >PF13815 Dzip-like_N: Iguana/Dzip1-like DAZ-interacting protein N-terminal | Back alignment and domain information |
|---|
| >PF06103 DUF948: Bacterial protein of unknown function (DUF948); InterPro: IPR009293 This family consists of bacterial sequences several of which are thought to be general stress proteins | Back alignment and domain information |
|---|
| >PRK02119 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] | Back alignment and domain information |
|---|
| >PF07889 DUF1664: Protein of unknown function (DUF1664); InterPro: IPR012458 The members of this family are hypothetical plant proteins of unknown function | Back alignment and domain information |
|---|
| >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >cd00632 Prefoldin_beta Prefoldin beta; Prefoldin is a hexameric molecular chaperone complex, composed of two evolutionarily related subunits (alpha and beta), which are found in both eukaryotes and archaea | Back alignment and domain information |
|---|
| >PF01166 TSC22: TSC-22/dip/bun family; InterPro: IPR000580 Several eukaryotic proteins are evolutionary related and are thought to be involved in transcriptional regulation | Back alignment and domain information |
|---|
| >PF04012 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 This family includes PspA a protein that suppresses sigma54-dependent transcription | Back alignment and domain information |
|---|
| >PF08172 CASP_C: CASP C terminal; InterPro: IPR012955 This domain is the C-terminal region of the CASP family of proteins | Back alignment and domain information |
|---|
| >PF07407 Seadorna_VP6: Seadornavirus VP6 protein; InterPro: IPR009982 This family consists of several VP6 proteins from the Banna virus as well as a related protein VP5 from the Kadipiro virus | Back alignment and domain information |
|---|
| >PF06103 DUF948: Bacterial protein of unknown function (DUF948); InterPro: IPR009293 This family consists of bacterial sequences several of which are thought to be general stress proteins | Back alignment and domain information |
|---|
| >PF10805 DUF2730: Protein of unknown function (DUF2730); InterPro: IPR020269 This entry represents a family of various hypothetical proteins | Back alignment and domain information |
|---|
| >PF04420 CHD5: CHD5-like protein; InterPro: IPR007514 Members of this family are probably coiled-coil proteins that are similar to the CHD5 (Congenital heart disease 5) protein | Back alignment and domain information |
|---|
| >KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK00846 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF08647 BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR013956 BRE1 is an E3 ubiquitin ligase that has been shown to act as a transcriptional activator through direct activator interactions [] | Back alignment and domain information |
|---|
| >COG1792 MreC Cell shape-determining protein [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PRK00295 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF10883 DUF2681: Protein of unknown function (DUF2681); InterPro: IPR020274 This entry contains membrane proteins with no known function | Back alignment and domain information |
|---|
| >KOG0982 consensus Centrosomal protein Nuf [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PF01763 Herpes_UL6: Herpesvirus UL6 like; InterPro: IPR002660 This family consists of various proteins from the Herpesviridae that are similar to Human herpesvirus 1 (HHV-1) UL6 virion protein | Back alignment and domain information |
|---|
| >COG2919 Septum formation initiator [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG4571 consensus Activating transcription factor 4 [Transcription] | Back alignment and domain information |
|---|
| >PRK02793 phi X174 lysis protein; Provisional | Back alignment and domain information |
|---|
| >PF09744 Jnk-SapK_ap_N: JNK_SAPK-associated protein-1; InterPro: IPR019143 This entry represents the N-terminal 200 residues of a set of proteins conserved from yeasts to humans | Back alignment and domain information |
|---|
| >COG3879 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK14148 heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >TIGR01834 PHA_synth_III_E poly(R)-hydroxyalkanoic acid synthase, class III, PhaE subunit | Back alignment and domain information |
|---|
| >PRK03947 prefoldin subunit alpha; Reviewed | Back alignment and domain information |
|---|
| >PF06698 DUF1192: Protein of unknown function (DUF1192); InterPro: IPR009579 This family consists of several short, hypothetical, bacterial proteins of around 60 residues in length | Back alignment and domain information |
|---|
| >PRK04325 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF04871 Uso1_p115_C: Uso1 / p115 like vesicle tethering protein, C terminal region; InterPro: IPR006955 This domain identifies a group of proteins, which are described as: General vesicular transport factor, Transcytosis associate protein (TAP) and Vesicle docking protein | Back alignment and domain information |
|---|
| >PF09766 FimP: Fms-interacting protein; InterPro: IPR019163 This entry represents Thoc5 which is one of the subunits of the THO complex, which additionally contains: HPR1, Thoc2, Thoc6 and Thoc7 | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PF14193 DUF4315: Domain of unknown function (DUF4315) | Back alignment and domain information |
|---|
| >PF02388 FemAB: FemAB family; InterPro: IPR003447 The femAB operon codes for two nearly identical approximately 50kDa proteins involved in the formation of the Staphylococcal pentaglycine interpeptide bridge in peptidoglycan [] | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >PF10018 Med4: Vitamin-D-receptor interacting Mediator subunit 4; InterPro: IPR019258 The Mediator complex is a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes | Back alignment and domain information |
|---|
| >COG5493 Uncharacterized conserved protein containing a coiled-coil domain [Function unknown] | Back alignment and domain information |
|---|
| >PF14257 DUF4349: Domain of unknown function (DUF4349) | Back alignment and domain information |
|---|
| >PF13600 DUF4140: N-terminal domain of unknown function (DUF4140) | Back alignment and domain information |
|---|
| >PF13870 DUF4201: Domain of unknown function (DUF4201) | Back alignment and domain information |
|---|
| >KOG4348 consensus Adaptor protein CMS/SETA [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF15188 CCDC-167: Coiled-coil domain-containing protein 167 | Back alignment and domain information |
|---|
| >PF05700 BCAS2: Breast carcinoma amplified sequence 2 (BCAS2); InterPro: IPR008409 This family consists of several eukaryotic sequences of unknown function | Back alignment and domain information |
|---|
| >PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function | Back alignment and domain information |
|---|
| >TIGR00414 serS seryl-tRNA synthetase | Back alignment and domain information |
|---|
| >PF04012 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 This family includes PspA a protein that suppresses sigma54-dependent transcription | Back alignment and domain information |
|---|
| >TIGR02977 phageshock_pspA phage shock protein A | Back alignment and domain information |
|---|
| >COG3879 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] | Back alignment and domain information |
|---|
| >PF04136 Sec34: Sec34-like family ; InterPro: IPR007265 Sec34 and Sec35 form a sub-complex in a seven-protein complex that includes Dor1 | Back alignment and domain information |
|---|
| >PF06657 Cep57_MT_bd: Centrosome microtubule-binding domain of Cep57; InterPro: IPR010597 This entry is thought to represent a centrosomal protein of 57 kDa (Cep57-related protein) | Back alignment and domain information |
|---|
| >PF14931 IFT20: Intraflagellar transport complex B, subunit 20 | Back alignment and domain information |
|---|
| >TIGR02338 gimC_beta prefoldin, beta subunit, archaeal | Back alignment and domain information |
|---|
| >COG1730 GIM5 Predicted prefoldin, molecular chaperone implicated in de novo protein folding [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >PF03954 Lectin_N: Hepatic lectin, N-terminal domain; InterPro: IPR005640 Animal lectins display a wide variety of architectures | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >cd07429 Cby_like Chibby, a nuclear inhibitor of Wnt/beta-catenin mediated transcription, and similar proteins | Back alignment and domain information |
|---|
| >PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] | Back alignment and domain information |
|---|
| >PF14523 Syntaxin_2: Syntaxin-like protein; PDB: 2DNX_A | Back alignment and domain information |
|---|
| >TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein | Back alignment and domain information |
|---|
| >PRK04406 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN02678 seryl-tRNA synthetase | Back alignment and domain information |
|---|
| >KOG2264 consensus Exostosin EXT1L [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF15035 Rootletin: Ciliary rootlet component, centrosome cohesion | Back alignment and domain information |
|---|
| >PF04645 DUF603: Protein of unknown function, DUF603; InterPro: IPR006739 This family includes several uncharacterised proteins from Borrelia species | Back alignment and domain information |
|---|
| >PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] | Back alignment and domain information |
|---|
| >PF05377 FlaC_arch: Flagella accessory protein C (FlaC); InterPro: IPR008039 Although archaeal flagella appear superficially similar to those of bacteria, they are quite distinct [] | Back alignment and domain information |
|---|
| >KOG3119 consensus Basic region leucine zipper transcription factor [Transcription] | Back alignment and domain information |
|---|
| >PF08826 DMPK_coil: DMPK coiled coil domain like; InterPro: IPR014930 This domain is found in the myotonic dystrophy protein kinase (DMPK) and adopts a coiled coil structure | Back alignment and domain information |
|---|
| >PF08286 Spc24: Spc24 subunit of Ndc80; InterPro: IPR013252 Spc24 is a component of the evolutionarily conserved kinetochore-associated Ndc80 complex and is involved in chromosome segregation [] | Back alignment and domain information |
|---|
| >TIGR00293 prefoldin, archaeal alpha subunit/eukaryotic subunit 5 | Back alignment and domain information |
|---|
| >TIGR00634 recN DNA repair protein RecN | Back alignment and domain information |
|---|
| >PF10779 XhlA: Haemolysin XhlA; InterPro: IPR019715 Haemolysin XhlA is a cell-surface associated haemolysin that lyses the two most prevalent types of insect immune cells (granulocytes and plasmatocytes) as well as rabbit and horse erythrocytes [] | Back alignment and domain information |
|---|
| >PRK09973 putative outer membrane lipoprotein; Provisional | Back alignment and domain information |
|---|
| >PF10267 Tmemb_cc2: Predicted transmembrane and coiled-coil 2 protein; InterPro: IPR019394 This family of transmembrane coiled-coil containing proteins is conserved from worms to humans | Back alignment and domain information |
|---|
| >TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >PF15458 NTR2: Nineteen complex-related protein 2 | Back alignment and domain information |
|---|
| >PF05103 DivIVA: DivIVA protein; InterPro: IPR007793 The Bacillus subtilis divIVA1 mutation causes misplacement of the septum during cell division, resulting in the formation of small, circular, anucleate minicells [] | Back alignment and domain information |
|---|
| >PRK14127 cell division protein GpsB; Provisional | Back alignment and domain information |
|---|
| >PF12999 PRKCSH-like: Glucosidase II beta subunit-like | Back alignment and domain information |
|---|
| >PF08647 BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR013956 BRE1 is an E3 ubiquitin ligase that has been shown to act as a transcriptional activator through direct activator interactions [] | Back alignment and domain information |
|---|
| >KOG4343 consensus bZIP transcription factor ATF6 [Transcription] | Back alignment and domain information |
|---|
| >PF14988 DUF4515: Domain of unknown function (DUF4515) | Back alignment and domain information |
|---|
| >PF13514 AAA_27: AAA domain | Back alignment and domain information |
|---|
| >KOG3647 consensus Predicted coiled-coil protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF04822 Takusan: Takusan; InterPro: IPR006907 This family includes several uncharacterised muridae (mouse and rat) proteins | Back alignment and domain information |
|---|
| >PRK14161 heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >KOG3433 consensus Protein involved in meiotic recombination/predicted coiled-coil protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02680 conserved hypothetical protein TIGR02680 | Back alignment and domain information |
|---|
| >PRK13923 putative spore coat protein regulator protein YlbO; Provisional | Back alignment and domain information |
|---|
| >PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >PF08738 Gon7: Gon7 family; InterPro: IPR014849 In Saccharomyces cerevisiae Gon7 is a member of the KEOPS protein complex | Back alignment and domain information |
|---|
| >PF12711 Kinesin-relat_1: Kinesin motor; InterPro: IPR024658 Kinesin [, , ] is a microtubule-associated force-producing protein that may play a role in organelle transport | Back alignment and domain information |
|---|
| >COG5509 Uncharacterized small protein containing a coiled-coil domain [Function unknown] | Back alignment and domain information |
|---|
| >COG2841 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF02050 FliJ: Flagellar FliJ protein; InterPro: IPR012823 Many flagellar proteins are exported by a flagellum-specific export pathway | Back alignment and domain information |
|---|
| >PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues | Back alignment and domain information |
|---|
| >KOG3433 consensus Protein involved in meiotic recombination/predicted coiled-coil protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF11544 Spc42p: Spindle pole body component Spc42p; InterPro: IPR021611 Spc42p is a 42kDa component of the S | Back alignment and domain information |
|---|
| >PF07047 OPA3: Optic atrophy 3 protein (OPA3); InterPro: IPR010754 OPA3 deficiency causes type III 3-methylglutaconic aciduria (MGA) in humans | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 136 | |||
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 2e-06 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 4e-06 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 1e-05 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 1e-05 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 4e-05 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 5e-05 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 7e-05 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 3e-04 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 5e-04 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 9e-04 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 2e-05 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 2e-05 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 8e-05 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 1e-04 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 2e-04 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 5e-04 | |
| 1nkp_A | 88 | C-MYC, MYC proto-oncogene protein; transcription, | 3e-05 | |
| 1nkp_B | 83 | MAX protein, MYC proto-oncogene protein; transcrip | 7e-05 | |
| 1jnm_A | 62 | Proto-oncogene C-JUN; BZIP, protein-DNA complex, t | 2e-04 | |
| 3lvg_D | 190 | LCB, clathrin light chain B; SELF assembly, coated | 3e-04 | |
| 1t2k_D | 61 | Cyclic-AMP-dependent transcription factor ATF-2; p | 4e-04 | |
| 1am9_A | 82 | Srebp-1A, protein (sterol regulatory element bindi | 6e-04 |
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
Score = 44.8 bits (106), Expect = 2e-06
Identities = 12/62 (19%), Positives = 30/62 (48%)
Query: 16 LSDVVRMMEQLRTEAQKLKQSTEDLQEKIKELKAEKNELRDEKQRLKADKEKLEQQVKAM 75
L++ + L K + +L+ ++K+ + + EL K++L+ + L +Q+ +
Sbjct: 1020 LAEEEEKAKNLTKLKNKHESMISELEVRLKKEEKSRQELEKIKRKLEGESSDLHEQIAEL 1079
Query: 76 SA 77
A
Sbjct: 1080 QA 1081
|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >1nkp_A C-MYC, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 Length = 88 | Back alignment and structure |
|---|
| >1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B Length = 83 | Back alignment and structure |
|---|
| >1jnm_A Proto-oncogene C-JUN; BZIP, protein-DNA complex, transcription/DNA complex; 2.20A {Homo sapiens} SCOP: h.1.3.1 PDB: 1fos_F 2h7h_A 1t2k_C 1a02_J* 1s9k_E 1jun_A Length = 62 | Back alignment and structure |
|---|
| >3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 | Back alignment and structure |
|---|
| >1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 Length = 61 | Back alignment and structure |
|---|
| >1am9_A Srebp-1A, protein (sterol regulatory element binding protein 1A); basic-helix-loop- helix-leucine zipper, transcription factor; HET: DNA; 2.30A {Homo sapiens} SCOP: a.38.1.1 PDB: 1ukl_C Length = 82 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 136 | |||
| 1am9_A | 82 | Srebp-1A, protein (sterol regulatory element bindi | 98.76 | |
| 1nkp_B | 83 | MAX protein, MYC proto-oncogene protein; transcrip | 98.49 | |
| 1nkp_A | 88 | C-MYC, MYC proto-oncogene protein; transcription, | 98.43 | |
| 4ati_A | 118 | MITF, microphthalmia-associated transcription fact | 98.18 | |
| 1nlw_A | 80 | MAD protein, MAX dimerizer; transcription factor, | 98.14 | |
| 2jee_A | 81 | YIIU; FTSZ, septum, coiled-coil, cell division, ce | 97.99 | |
| 1hlo_A | 80 | Protein (transcription factor MAX); transcriptiona | 97.97 | |
| 4h10_B | 71 | Circadian locomoter output cycles protein kaput; B | 97.54 | |
| 4ath_A | 83 | MITF, microphthalmia-associated transcription fact | 97.26 | |
| 3hnw_A | 138 | Uncharacterized protein; coiled-coil, structural g | 97.13 | |
| 2jee_A | 81 | YIIU; FTSZ, septum, coiled-coil, cell division, ce | 96.91 | |
| 1an4_A | 65 | Protein (upstream stimulatory factor); protein-DNA | 96.63 | |
| 3hnw_A | 138 | Uncharacterized protein; coiled-coil, structural g | 96.29 | |
| 4h10_A | 73 | ARYL hydrocarbon receptor nuclear translocator-LI | 96.25 | |
| 2yy0_A | 53 | C-MYC-binding protein; conserved hypothetical prot | 96.19 | |
| 3he5_B | 52 | Synzip2; heterodimeric coiled-coil, de novo protei | 96.0 | |
| 1gd2_E | 70 | Transcription factor PAP1; basic leucine zipper, p | 95.96 | |
| 2wt7_A | 63 | Proto-oncogene protein C-FOS; transcription, trans | 95.86 | |
| 3q8t_A | 96 | Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90 | 95.61 | |
| 1t2k_D | 61 | Cyclic-AMP-dependent transcription factor ATF-2; p | 95.58 | |
| 1a0a_A | 63 | BHLH, protein (phosphate system positive regulator | 95.47 | |
| 1t2k_D | 61 | Cyclic-AMP-dependent transcription factor ATF-2; p | 95.23 | |
| 3tnu_B | 129 | Keratin, type II cytoskeletal 5; coiled-coil, stru | 95.2 | |
| 2wt7_A | 63 | Proto-oncogene protein C-FOS; transcription, trans | 94.91 | |
| 3i00_A | 120 | HIP-I, huntingtin-interacting protein 1; transcrip | 94.83 | |
| 2v66_B | 111 | Nuclear distribution protein NUDE-like 1; structur | 94.81 | |
| 4etp_A | 403 | Kinesin-like protein KAR3; kinesin motor protein, | 94.79 | |
| 1go4_E | 100 | MAD1 (mitotic arrest deficient)-like 1; mitotic sp | 94.75 | |
| 1jnm_A | 62 | Proto-oncogene C-JUN; BZIP, protein-DNA complex, t | 94.75 | |
| 3a7p_A | 152 | Autophagy protein 16; coiled-coil, coiled coil, cy | 94.74 | |
| 1ci6_A | 63 | Transcription factor ATF-4; BZIP; 2.60A {Homo sapi | 94.7 | |
| 3tnu_A | 131 | Keratin, type I cytoskeletal 14; coiled-coil, stru | 94.6 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 94.43 | |
| 3m9b_A | 251 | Proteasome-associated ATPase; coil COIL with 5 bet | 94.43 | |
| 2fxo_A | 129 | Myosin heavy chain, cardiac muscle beta isoform; c | 94.26 | |
| 2eqb_B | 97 | RAB guanine nucleotide exchange factor SEC2; coile | 94.25 | |
| 1ci6_A | 63 | Transcription factor ATF-4; BZIP; 2.60A {Homo sapi | 94.22 | |
| 2oqq_A | 42 | Transcription factor HY5; homodimer leucine zipper | 94.14 | |
| 3nmd_A | 72 | CGMP dependent protein kinase; leucine zipper, coi | 94.13 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 94.05 | |
| 2v71_A | 189 | Nuclear distribution protein NUDE-like 1; developm | 94.03 | |
| 1jnm_A | 62 | Proto-oncogene C-JUN; BZIP, protein-DNA complex, t | 93.98 | |
| 3bas_A | 89 | Myosin heavy chain, striated muscle/general contro | 93.96 | |
| 3m9b_A | 251 | Proteasome-associated ATPase; coil COIL with 5 bet | 93.88 | |
| 3cve_A | 72 | Homer protein homolog 1; coiled coil, alternative | 93.87 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 93.77 | |
| 3qh9_A | 81 | Liprin-beta-2; coiled-coil, dimerization, structur | 93.67 | |
| 3u06_A | 412 | Protein claret segregational; motor domain, stalk | 93.65 | |
| 1go4_E | 100 | MAD1 (mitotic arrest deficient)-like 1; mitotic sp | 93.44 | |
| 1gd2_E | 70 | Transcription factor PAP1; basic leucine zipper, p | 93.43 | |
| 3m91_A | 51 | Proteasome-associated ATPase; coil COIL alpha heli | 93.42 | |
| 3s4r_A | 93 | Vimentin; alpha-helix, cytoskeleton, intermediate | 93.41 | |
| 1deb_A | 54 | APC protein, adenomatous polyposis coli protein; c | 93.37 | |
| 1ik9_A | 213 | DNA repair protein XRCC4; DNA END joining, double- | 93.36 | |
| 3a7p_A | 152 | Autophagy protein 16; coiled-coil, coiled coil, cy | 93.27 | |
| 3vmx_A | 48 | Voltage-gated hydrogen channel 1; coiled-coil, ION | 93.2 | |
| 4b4t_K | 428 | 26S protease regulatory subunit 6B homolog; hydrol | 93.15 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 93.09 | |
| 3cvf_A | 79 | Homer-3, homer protein homolog 3; coiled coil, alt | 93.07 | |
| 3u5v_A | 76 | Protein MAX, transcription factor E2-alpha chimer; | 93.04 | |
| 2oto_A | 155 | M protein; helical coiled coil, fibrinogen-binding | 92.99 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 92.98 | |
| 3he5_A | 49 | Synzip1; heterodimeric coiled-coil, de novo protei | 92.98 | |
| 1hjb_A | 87 | Ccaat/enhancer binding protein beta; transcription | 92.89 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 92.84 | |
| 2fxo_A | 129 | Myosin heavy chain, cardiac muscle beta isoform; c | 92.83 | |
| 3htk_A | 60 | Structural maintenance of chromosomes protein 5; S | 92.68 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 92.63 | |
| 1nkp_B | 83 | MAX protein, MYC proto-oncogene protein; transcrip | 92.56 | |
| 1dh3_A | 55 | Transcription factor CREB; protein-DNA complex, tr | 92.54 | |
| 1zhc_A | 76 | Hypothetical protein HP1242; A-helical protein, un | 92.34 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 92.32 | |
| 3m91_A | 51 | Proteasome-associated ATPase; coil COIL alpha heli | 92.3 | |
| 3i00_A | 120 | HIP-I, huntingtin-interacting protein 1; transcrip | 92.18 | |
| 2wt7_B | 90 | Transcription factor MAFB; transcription, transcri | 91.94 | |
| 2oxj_A | 34 | Hybrid alpha/beta peptide based on the GCN4-P1 Se | 91.81 | |
| 3ol1_A | 119 | Vimentin; structural genomics, PSI-2, protein stru | 91.77 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 91.69 | |
| 2v71_A | 189 | Nuclear distribution protein NUDE-like 1; developm | 91.58 | |
| 3oa7_A | 206 | Head morphogenesis protein, chaotic nuclear migra | 91.53 | |
| 2yy0_A | 53 | C-MYC-binding protein; conserved hypothetical prot | 91.46 | |
| 1hjb_A | 87 | Ccaat/enhancer binding protein beta; transcription | 91.33 | |
| 1gu4_A | 78 | CAAT/enhancer binding protein beta; transcription/ | 91.27 | |
| 1wle_A | 501 | Seryl-tRNA synthetase; ligase; HET: SRP; 1.65A {Bo | 91.22 | |
| 1gk6_A | 59 | Vimentin; intermediate filament, dimer, parallel c | 91.2 | |
| 3v86_A | 27 | De novo design helix; computational design of A pr | 91.16 | |
| 4f3l_A | 361 | Mclock, circadian locomoter output cycles protein | 91.08 | |
| 2v66_B | 111 | Nuclear distribution protein NUDE-like 1; structur | 90.9 | |
| 2dq0_A | 455 | Seryl-tRNA synthetase; coiled-coil, homodimer, str | 90.8 | |
| 3s9g_A | 104 | Protein hexim1; cyclin T-binding domain (TBD), cyc | 90.78 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 90.74 | |
| 2dgc_A | 63 | Protein (GCN4); basic domain, leucine zipper, DNA | 90.69 | |
| 3q8t_A | 96 | Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90 | 90.68 | |
| 1wle_A | 501 | Seryl-tRNA synthetase; ligase; HET: SRP; 1.65A {Bo | 90.67 | |
| 2ocy_A | 154 | RAB guanine nucleotide exchange factor SEC2; RAB, | 90.6 | |
| 2w83_C | 77 | C-JUN-amino-terminal kinase-interacting protein 4; | 90.45 | |
| 3mq7_A | 121 | Bone marrow stromal antigen 2; HIV, antiviral prot | 90.41 | |
| 1lwu_C | 323 | Fibrinogen gamma chain; heterotrimer, protein-pept | 90.39 | |
| 3iv1_A | 78 | Tumor susceptibility gene 101 protein; coiled_COIL | 90.32 | |
| 3bas_A | 89 | Myosin heavy chain, striated muscle/general contro | 90.22 | |
| 3qne_A | 485 | Seryl-tRNA synthetase, cytoplasmic; amino acid bio | 90.21 | |
| 3c3g_A | 33 | Alpha/beta peptide with the GCN4-PLI SIDE chain S | 90.17 | |
| 3trt_A | 77 | Vimentin; cytoskeleton, intermediate filament, alp | 90.07 | |
| 3a2a_A | 58 | Voltage-gated hydrogen channel 1; voltage-gated pr | 90.04 | |
| 3u1c_A | 101 | Tropomyosin alpha-1 chain; anti-parallel coiled co | 89.81 | |
| 2w6a_A | 63 | ARF GTPase-activating protein GIT1; PIX, zinc, sig | 89.79 | |
| 2dgc_A | 63 | Protein (GCN4); basic domain, leucine zipper, DNA | 89.76 | |
| 2j5u_A | 255 | MREC protein; bacterial cell shape determining pro | 89.71 | |
| 3m48_A | 33 | General control protein GCN4; leucine zipper, synt | 89.55 | |
| 3u59_A | 101 | Tropomyosin beta chain; muscle contraction, actin, | 89.48 | |
| 2no2_A | 107 | HIP-I, huntingtin-interacting protein 1; clathrin | 89.35 | |
| 1ses_A | 421 | Seryl-tRNA synthetase; ligase; HET: AHX AMP; 2.50A | 89.35 | |
| 1wt6_A | 81 | Myotonin-protein kinase; coiled-coil, kinase activ | 89.33 | |
| 1nlw_A | 80 | MAD protein, MAX dimerizer; transcription factor, | 89.28 | |
| 1uix_A | 71 | RHO-associated kinase; coiled-coil, transferase; H | 89.23 | |
| 1l8d_A | 112 | DNA double-strand break repair RAD50 ATPase; zinc | 89.15 | |
| 3c3f_A | 34 | Alpha/beta peptide with the GCN4-PLI SIDE chain S | 89.08 | |
| 1x8y_A | 86 | Lamin A/C; structural protein, intermediate filame | 89.06 | |
| 3htk_A | 60 | Structural maintenance of chromosomes protein 5; S | 89.02 | |
| 1gk4_A | 84 | Vimentin; intermediate filament, dimer, parallel c | 89.01 | |
| 2wq1_A | 33 | General control protein GCN4; TAA, nucleus, coiled | 88.85 | |
| 4f3l_B | 387 | BMAL1B; BHLH, PAS, circadian rhythm proteins, tran | 88.76 | |
| 2v4h_A | 110 | NF-kappa-B essential modulator; transcription, met | 88.43 | |
| 1gu4_A | 78 | CAAT/enhancer binding protein beta; transcription/ | 88.16 | |
| 3swk_A | 86 | Vimentin; cytoskeleton, intermediate filament, alp | 87.79 | |
| 1kd8_B | 36 | GABH BLL, GCN4 acid base heterodimer base-D12LA16L | 87.59 | |
| 3iv1_A | 78 | Tumor susceptibility gene 101 protein; coiled_COIL | 87.44 | |
| 1uii_A | 83 | Geminin; human, DNA replication, cell cycle; 2.00A | 87.37 | |
| 1wlq_A | 83 | Geminin; coiled-coil; 2.80A {Mus musculus} PDB: 2z | 87.28 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 87.1 | |
| 3trt_A | 77 | Vimentin; cytoskeleton, intermediate filament, alp | 86.99 | |
| 1ic2_A | 81 | Tropomyosin alpha chain, skeletal muscle; alpha-he | 86.65 | |
| 4h22_A | 103 | Leucine-rich repeat flightless-interacting protei; | 86.64 | |
| 2wt7_B | 90 | Transcription factor MAFB; transcription, transcri | 86.55 | |
| 2xv5_A | 74 | Lamin-A/C; structural protein, intermediate filame | 86.47 | |
| 2bni_A | 34 | General control protein GCN4; four helix bundle, a | 86.43 | |
| 1jcd_A | 52 | Major outer membrane lipoprotein; protein folding, | 86.13 | |
| 2eqb_B | 97 | RAB guanine nucleotide exchange factor SEC2; coile | 86.01 | |
| 1uo4_A | 34 | General control protein GCN4; four helix bundle, c | 85.94 | |
| 4h22_A | 103 | Leucine-rich repeat flightless-interacting protei; | 85.79 | |
| 1dh3_A | 55 | Transcription factor CREB; protein-DNA complex, tr | 85.38 | |
| 2w83_C | 77 | C-JUN-amino-terminal kinase-interacting protein 4; | 85.38 | |
| 1ik9_A | 213 | DNA repair protein XRCC4; DNA END joining, double- | 85.37 | |
| 1kd8_A | 36 | GABH AIV, GCN4 acid base heterodimer acid-D12IA16V | 85.17 | |
| 3w03_C | 184 | DNA repair protein XRCC4; coiled-coil, NHEJ, DSBS | 85.11 | |
| 1a93_B | 34 | MAX protein, coiled coil, LZ; leucine zipper, 2D s | 85.0 | |
| 3oa7_A | 206 | Head morphogenesis protein, chaotic nuclear migra | 84.87 | |
| 3u1c_A | 101 | Tropomyosin alpha-1 chain; anti-parallel coiled co | 84.8 | |
| 1lwu_C | 323 | Fibrinogen gamma chain; heterotrimer, protein-pept | 84.69 | |
| 3efg_A | 78 | Protein SLYX homolog; xanthomonas campestris PV. c | 84.57 | |
| 2zxx_A | 79 | Geminin; coiled-coil, cell cycle, coiled coil, DNA | 84.56 | |
| 4b4t_K | 428 | 26S protease regulatory subunit 6B homolog; hydrol | 84.56 | |
| 1gk4_A | 84 | Vimentin; intermediate filament, dimer, parallel c | 84.47 | |
| 2hy6_A | 34 | General control protein GCN4; protein design, para | 84.41 | |
| 4etp_A | 403 | Kinesin-like protein KAR3; kinesin motor protein, | 84.39 | |
| 2zxx_A | 79 | Geminin; coiled-coil, cell cycle, coiled coil, DNA | 84.35 | |
| 3ibp_A | 302 | Chromosome partition protein MUKB; structural main | 84.29 | |
| 2ve7_A | 315 | Kinetochore protein HEC1, kinetochore protein SPC; | 84.18 | |
| 1ic2_A | 81 | Tropomyosin alpha chain, skeletal muscle; alpha-he | 84.12 | |
| 2wg5_A | 109 | General control protein GCN4, proteasome-activatin | 83.87 | |
| 2zvf_A | 171 | Alanyl-tRNA synthetase; C-terminal, oligomerizatio | 83.85 | |
| 2xdj_A | 83 | Uncharacterized protein YBGF; unknown function; 1. | 83.85 | |
| 3tnu_B | 129 | Keratin, type II cytoskeletal 5; coiled-coil, stru | 83.83 | |
| 1s1c_X | 71 | RHO-associated, coiled-coil containing protein kin | 83.71 | |
| 2dq3_A | 425 | Seryl-tRNA synthetase; coiled-coil, homodimer, str | 83.67 | |
| 1nkp_A | 88 | C-MYC, MYC proto-oncogene protein; transcription, | 83.46 | |
| 3ghg_A | 562 | Fibrinogen alpha chain; triple-stranded coiled coi | 83.22 | |
| 2xdj_A | 83 | Uncharacterized protein YBGF; unknown function; 1. | 83.14 | |
| 2v4h_A | 110 | NF-kappa-B essential modulator; transcription, met | 83.12 | |
| 3he4_B | 46 | Synzip5; heterodimeric coiled-coil, de novo protei | 83.08 | |
| 1l8d_A | 112 | DNA double-strand break repair RAD50 ATPase; zinc | 83.03 | |
| 3u06_A | 412 | Protein claret segregational; motor domain, stalk | 82.93 | |
| 4dzn_A | 33 | Coiled-coil peptide CC-PIL; de novo protein; HET: | 82.79 | |
| 3tnu_A | 131 | Keratin, type I cytoskeletal 14; coiled-coil, stru | 82.76 | |
| 4aj5_1 | 101 | SKA3, spindle and kinetochore-associated protein 3 | 82.73 | |
| 3rrk_A | 357 | V-type ATPase 116 kDa subunit; alpha beta fold, pr | 82.71 | |
| 1dip_A | 78 | Delta-sleep-inducing peptide immunoreactive peptid | 82.48 | |
| 3m48_A | 33 | General control protein GCN4; leucine zipper, synt | 82.38 | |
| 2zqm_A | 117 | Prefoldin beta subunit 1; chaperone; HET: CIT; 1.9 | 82.37 | |
| 3u59_A | 101 | Tropomyosin beta chain; muscle contraction, actin, | 82.29 | |
| 3nmd_A | 72 | CGMP dependent protein kinase; leucine zipper, coi | 82.26 | |
| 1wt6_A | 81 | Myotonin-protein kinase; coiled-coil, kinase activ | 82.08 | |
| 4b4t_M | 434 | 26S protease regulatory subunit 6A; hydrolase, AAA | 82.06 | |
| 3lss_A | 484 | Seryl-tRNA synthetase; aminoacyl-tRNA synthetase, | 82.02 | |
| 3lss_A | 484 | Seryl-tRNA synthetase; aminoacyl-tRNA synthetase, | 81.87 | |
| 3rrk_A | 357 | V-type ATPase 116 kDa subunit; alpha beta fold, pr | 80.79 | |
| 3ni0_A | 99 | Bone marrow stromal antigen 2; coiled-coil, antivi | 80.75 | |
| 2zqm_A | 117 | Prefoldin beta subunit 1; chaperone; HET: CIT; 1.9 | 80.7 | |
| 3a7o_A | 75 | Autophagy protein 16; coiled-coil, coiled coil, cy | 80.66 | |
| 2wvr_A | 209 | Geminin; DNA replication license, DNA replication | 80.55 | |
| 2wvr_A | 209 | Geminin; DNA replication license, DNA replication | 80.52 | |
| 4b4t_J | 405 | 26S protease regulatory subunit 8 homolog; hydrola | 80.48 | |
| 4aj5_K | 123 | Spindle and kinetochore-associated protein 2; cell | 80.43 | |
| 3mov_A | 95 | Lamin-B1; LMNB1, B-type lamins, intermediate filam | 80.28 | |
| 1uii_A | 83 | Geminin; human, DNA replication, cell cycle; 2.00A | 80.11 | |
| 1kd8_B | 36 | GABH BLL, GCN4 acid base heterodimer base-D12LA16L | 80.07 | |
| 1kd8_A | 36 | GABH AIV, GCN4 acid base heterodimer acid-D12IA16V | 80.07 | |
| 2ve7_C | 250 | Kinetochore protein NUF2, kinetochore protein SPC; | 80.06 |
| >1am9_A Srebp-1A, protein (sterol regulatory element binding protein 1A); basic-helix-loop- helix-leucine zipper, transcription factor; HET: DNA; 2.30A {Homo sapiens} SCOP: a.38.1.1 PDB: 1ukl_C | Back alignment and structure |
|---|
Probab=98.76 E-value=2.1e-08 Score=69.21 Aligned_cols=45 Identities=27% Similarity=0.402 Sum_probs=40.6
Q ss_pred CCCCCCCchhhhHHHHHHHHHHHHHHHHHHHHhhHHHHHHHHHHH
Q 032672 4 PGRPPKTDKATILSDVVRMMEQLRTEAQKLKQSTEDLQEKIKELK 48 (136)
Q Consensus 4 P~rp~K~DKAsIL~DAir~lkqLr~e~~~Lk~~n~~L~ee~~~L~ 48 (136)
|+...|+|||+||.+||.||+.|+.+++.|+++++.|+..++..+
T Consensus 33 P~~~~k~~Ka~IL~~Ai~YI~~Lq~~~~~L~~e~~~L~~~~~~~~ 77 (82)
T 1am9_A 33 VGTEAKLNKSAVLRKAIDYIRFLQHSNQKLKQENLSLRTAVHKSK 77 (82)
T ss_dssp TCSSCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred cCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhh
Confidence 555589999999999999999999999999999999999887654
|
| >1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B | Back alignment and structure |
|---|
| >1nkp_A C-MYC, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 | Back alignment and structure |
|---|
| >4ati_A MITF, microphthalmia-associated transcription factor; DNA-binding protein-DNA complex, melanoma; 2.60A {Mus musculus} PDB: 4atk_A | Back alignment and structure |
|---|
| >1nlw_A MAD protein, MAX dimerizer; transcription factor, DNA, BHLHZ, transcription/DNA complex; 2.00A {Homo sapiens} SCOP: a.38.1.1 | Back alignment and structure |
|---|
| >2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} | Back alignment and structure |
|---|
| >1hlo_A Protein (transcription factor MAX); transcriptional regulation, DNA binding, complex (transcription factor MAX/DNA), transcription/DNA complex; HET: DNA; 2.80A {Homo sapiens} SCOP: a.38.1.1 | Back alignment and structure |
|---|
| >4h10_B Circadian locomoter output cycles protein kaput; BHLH, circadian transcription, transcription-DNA complex; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >4ath_A MITF, microphthalmia-associated transcription factor; DNA binding protein, melanoma; HET: MSE; 1.95A {Mus musculus} | Back alignment and structure |
|---|
| >3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} | Back alignment and structure |
|---|
| >2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} | Back alignment and structure |
|---|
| >1an4_A Protein (upstream stimulatory factor); protein-DNA complex, double helix, overhanging base, transcription/DNA complex; HET: DNA; 2.90A {Homo sapiens} SCOP: a.38.1.1 | Back alignment and structure |
|---|
| >3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} | Back alignment and structure |
|---|
| >4h10_A ARYL hydrocarbon receptor nuclear translocator-LI 1; BHLH, circadian transcription, transcription-DNA complex; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2yy0_A C-MYC-binding protein; conserved hypothetical protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3he5_B Synzip2; heterodimeric coiled-coil, de novo protein; 1.75A {Artificial gene} | Back alignment and structure |
|---|
| >1gd2_E Transcription factor PAP1; basic leucine zipper, protein-DNA complex, transcription/DNA complex; HET: DNA; 2.00A {Schizosaccharomyces pombe} SCOP: h.1.3.1 | Back alignment and structure |
|---|
| >2wt7_A Proto-oncogene protein C-FOS; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 1fos_E* 1a02_F* 1s9k_D | Back alignment and structure |
|---|
| >3q8t_A Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 | Back alignment and structure |
|---|
| >1a0a_A BHLH, protein (phosphate system positive regulatory protein PHO4); transcription factor, basic helix loop helix; HET: DNA; 2.80A {Saccharomyces cerevisiae} SCOP: a.38.1.1 | Back alignment and structure |
|---|
| >1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 | Back alignment and structure |
|---|
| >3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2wt7_A Proto-oncogene protein C-FOS; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 1fos_E* 1a02_F* 1s9k_D | Back alignment and structure |
|---|
| >3i00_A HIP-I, huntingtin-interacting protein 1; transcription; 2.30A {Homo sapiens} PDB: 2qa7_A | Back alignment and structure |
|---|
| >2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1go4_E MAD1 (mitotic arrest deficient)-like 1; mitotic spindle checkpoint, cell cycle, mitosis, nuclear Pro; 2.05A {Homo sapiens} SCOP: h.1.22.1 | Back alignment and structure |
|---|
| >1jnm_A Proto-oncogene C-JUN; BZIP, protein-DNA complex, transcription/DNA complex; 2.20A {Homo sapiens} SCOP: h.1.3.1 PDB: 1fos_F 2h7h_A 1t2k_C 1a02_J* 1s9k_E 1jun_A | Back alignment and structure |
|---|
| >3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 | Back alignment and structure |
|---|
| >3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} | Back alignment and structure |
|---|
| >3m9b_A Proteasome-associated ATPase; coil COIL with 5 beta-strand barrel inter domain, chaperone; 3.94A {Mycobacterium tuberculosis} PDB: 3m9d_A | Back alignment and structure |
|---|
| >2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A | Back alignment and structure |
|---|
| >2eqb_B RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 2.70A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 | Back alignment and structure |
|---|
| >2oqq_A Transcription factor HY5; homodimer leucine zipper; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3nmd_A CGMP dependent protein kinase; leucine zipper, coiled-coil, structural genomics, berkeley S genomics center, BSGC, dimerization; HET: MSE; 2.27A {Homo sapiens} | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1jnm_A Proto-oncogene C-JUN; BZIP, protein-DNA complex, transcription/DNA complex; 2.20A {Homo sapiens} SCOP: h.1.3.1 PDB: 1fos_F 2h7h_A 1t2k_C 1a02_J* 1s9k_E 1jun_A | Back alignment and structure |
|---|
| >3bas_A Myosin heavy chain, striated muscle/general control protein GCN4 chimera; alpha-helical coiled coil, disorder, salt links; 2.30A {Argopecten irradians} SCOP: h.1.26.1 PDB: 1nkn_A 3bat_A | Back alignment and structure |
|---|
| >3m9b_A Proteasome-associated ATPase; coil COIL with 5 beta-strand barrel inter domain, chaperone; 3.94A {Mycobacterium tuberculosis} PDB: 3m9d_A | Back alignment and structure |
|---|
| >3cve_A Homer protein homolog 1; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, postsynaptic cell membrane, synapse; 1.75A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3qh9_A Liprin-beta-2; coiled-coil, dimerization, structural protein; 2.01A {Homo sapiens} | Back alignment and structure |
|---|
| >3u06_A Protein claret segregational; motor domain, stalk rotation, power stroke, kinesin-14, MICR binding, NCD, transport, molecular motor; HET: ADP GOL; 2.35A {Drosophila melanogaster} PDB: 2ncd_A* 1n6m_A* 1cz7_A* 3l1c_A* | Back alignment and structure |
|---|
| >1go4_E MAD1 (mitotic arrest deficient)-like 1; mitotic spindle checkpoint, cell cycle, mitosis, nuclear Pro; 2.05A {Homo sapiens} SCOP: h.1.22.1 | Back alignment and structure |
|---|
| >1gd2_E Transcription factor PAP1; basic leucine zipper, protein-DNA complex, transcription/DNA complex; HET: DNA; 2.00A {Schizosaccharomyces pombe} SCOP: h.1.3.1 | Back alignment and structure |
|---|
| >3m91_A Proteasome-associated ATPase; coil COIL alpha helix, ATP-binding, chaperone, nucleotide-BI proteasome, S-nitrosylation; 1.80A {Mycobacterium tuberculosis} PDB: 3m9h_A | Back alignment and structure |
|---|
| >3s4r_A Vimentin; alpha-helix, cytoskeleton, intermediate filament, structural; 2.45A {Homo sapiens} PDB: 3ssu_A | Back alignment and structure |
|---|
| >1deb_A APC protein, adenomatous polyposis coli protein; coiled coil, tumor suppressor, structural protein; 2.40A {Homo sapiens} SCOP: h.1.18.1 | Back alignment and structure |
|---|
| >1ik9_A DNA repair protein XRCC4; DNA END joining, double-strand break repair, V(D)J recombination, protein-protein complex, coiled coil; HET: DNA; 2.30A {Homo sapiens} SCOP: b.59.1.1 h.1.11.1 PDB: 3ii6_A* 1fu1_A* 3rwr_A* | Back alignment and structure |
|---|
| >3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3vmx_A Voltage-gated hydrogen channel 1; coiled-coil, ION channel, ION transport, membrane protein; 1.45A {Mus musculus} | Back alignment and structure |
|---|
| >4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3cvf_A Homer-3, homer protein homolog 3; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, phosphoprotein, polymorphism; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3u5v_A Protein MAX, transcription factor E2-alpha chimer; basic helix-loop-helix (BHLH); 1.70A {Mus musculus} PDB: 2ql2_A* | Back alignment and structure |
|---|
| >2oto_A M protein; helical coiled coil, fibrinogen-binding, virulence factor, S active protein, toxin; 3.04A {Streptococcus pyogenes serotype M1} PDB: 2xny_M | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} | Back alignment and structure |
|---|
| >3he5_A Synzip1; heterodimeric coiled-coil, de novo protein; 1.75A {Artificial gene} | Back alignment and structure |
|---|
| >1hjb_A Ccaat/enhancer binding protein beta; transcription/DNA, protein-DNA complex; HET: DNA; 3.0A {Homo sapiens} SCOP: h.1.3.1 | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} | Back alignment and structure |
|---|
| >2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A | Back alignment and structure |
|---|
| >3htk_A Structural maintenance of chromosomes protein 5; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B | Back alignment and structure |
|---|
| >1dh3_A Transcription factor CREB; protein-DNA complex, transcription/DNA complex; HET: DNA; 3.00A {Mus musculus} SCOP: h.1.3.1 | Back alignment and structure |
|---|
| >1zhc_A Hypothetical protein HP1242; A-helical protein, unknown function; NMR {Helicobacter pylori} | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} | Back alignment and structure |
|---|
| >3m91_A Proteasome-associated ATPase; coil COIL alpha helix, ATP-binding, chaperone, nucleotide-BI proteasome, S-nitrosylation; 1.80A {Mycobacterium tuberculosis} PDB: 3m9h_A | Back alignment and structure |
|---|
| >3i00_A HIP-I, huntingtin-interacting protein 1; transcription; 2.30A {Homo sapiens} PDB: 2qa7_A | Back alignment and structure |
|---|
| >2wt7_B Transcription factor MAFB; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 2wty_A* 1k1v_A | Back alignment and structure |
|---|
| >2oxj_A Hybrid alpha/beta peptide based on the GCN4-P1 Se heptad positions B and F substituted...; helix bundle, foldamer, unknown function; HET: B3K B3D B3E B3S B3Y B3X B3A BAL; 2.00A {Synthetic} PDB: 2oxk_A* | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3oa7_A Head morphogenesis protein, chaotic nuclear migra protein 67 fusion protein; coiled coils, structural protein, spindle POLE BODY; 2.30A {Bacillus phage PHI29} | Back alignment and structure |
|---|
| >2yy0_A C-MYC-binding protein; conserved hypothetical protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1hjb_A Ccaat/enhancer binding protein beta; transcription/DNA, protein-DNA complex; HET: DNA; 3.0A {Homo sapiens} SCOP: h.1.3.1 | Back alignment and structure |
|---|
| >1gu4_A CAAT/enhancer binding protein beta; transcription/DNA, protein-DNA complex, transcription factor, BZIP, C/EBP; 1.80A {Homo sapiens} SCOP: h.1.3.1 PDB: 1gtw_A 1gu5_A 1h88_A 1h8a_A 1io4_A 2e43_A* 2e42_A* 1h89_A 1ci6_B 1nwq_A | Back alignment and structure |
|---|
| >1wle_A Seryl-tRNA synthetase; ligase; HET: SRP; 1.65A {Bos taurus} | Back alignment and structure |
|---|
| >1gk6_A Vimentin; intermediate filament, dimer, parallel coiled coil, heptad repeat, leucine zipper, fusion protein; 1.9A {Saccharomyces cerevisiae} SCOP: h.1.20.1 | Back alignment and structure |
|---|
| >3v86_A De novo design helix; computational design of A protein crystal, helical coil, DE designed helix, de novo protein; 2.91A {Synthetic} | Back alignment and structure |
|---|
| >4f3l_A Mclock, circadian locomoter output cycles protein kaput; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} | Back alignment and structure |
|---|
| >2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2dq0_A Seryl-tRNA synthetase; coiled-coil, homodimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: SSA; 2.60A {Pyrococcus horikoshii} PDB: 2dq1_A* 2dq2_A 2zr2_A* 2zr3_A | Back alignment and structure |
|---|
| >3s9g_A Protein hexim1; cyclin T-binding domain (TBD), cyclin T1/P-TEFB/7SK snRNA, N transcription; 2.10A {Homo sapiens} PDB: 2gd7_A | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2dgc_A Protein (GCN4); basic domain, leucine zipper, DNA binding, eukaryotic regulatory protein, transcription/DNA complex; HET: DNA; 2.20A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1dgc_A* 1ld4_E 1ysa_C* 3p8m_D | Back alignment and structure |
|---|
| >3q8t_A Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1wle_A Seryl-tRNA synthetase; ligase; HET: SRP; 1.65A {Bos taurus} | Back alignment and structure |
|---|
| >2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >2w83_C C-JUN-amino-terminal kinase-interacting protein 4; golgi apparatus, protein transport, ER-golgi transport, ARF, GTPase, effector, myristate; HET: GTP; 1.93A {Homo sapiens} | Back alignment and structure |
|---|
| >3mq7_A Bone marrow stromal antigen 2; HIV, antiviral protein; 2.28A {Homo sapiens} PDB: 3mqc_A 3mqb_A 3mkx_A 3nwh_A 2xg7_A* 2x7a_A | Back alignment and structure |
|---|
| >1lwu_C Fibrinogen gamma chain; heterotrimer, protein-peptide complex, blood clotting; HET: NDG MAN NAG BMA GAL; 2.80A {Petromyzon marinus} SCOP: d.171.1.1 h.1.8.1 PDB: 1n73_C* | Back alignment and structure |
|---|
| >3iv1_A Tumor susceptibility gene 101 protein; coiled_COIL, tumorigenesis, CELL_cycle regulation, alternative splicing, cell cycle, cell division; HET: MSE; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3bas_A Myosin heavy chain, striated muscle/general control protein GCN4 chimera; alpha-helical coiled coil, disorder, salt links; 2.30A {Argopecten irradians} SCOP: h.1.26.1 PDB: 1nkn_A 3bat_A | Back alignment and structure |
|---|
| >3qne_A Seryl-tRNA synthetase, cytoplasmic; amino acid biosynthesis, CTG-clade, codon ambiguity, pathoge II aminoacyl-tRNA synthetase family; 2.00A {Candida albicans} PDB: 3qo7_A* 3qo8_A* 3qo5_A | Back alignment and structure |
|---|
| >3c3g_A Alpha/beta peptide with the GCN4-PLI SIDE chain S AN (alpha-alpha-beta) backbone; helix bundle, foldamer, unknown function protein; HET: HMR B3Q B3D B3E B3L BIL B3K BAL GOL; 1.80A {Synthetic} PDB: 3heu_A* 3het_A* 3hev_A* 3hew_A* 3hey_A* 3hex_A* 3c3h_A* | Back alignment and structure |
|---|
| >3trt_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural protein; 2.30A {Homo sapiens} PDB: 3klt_A* | Back alignment and structure |
|---|
| >3a2a_A Voltage-gated hydrogen channel 1; voltage-gated proton channel, alternative splicing, coiled C transport, ionic channel, membrane, transmembrane; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A | Back alignment and structure |
|---|
| >2w6a_A ARF GTPase-activating protein GIT1; PIX, zinc, signaling protein, CAT-1, cytoplasm, ANK repeat, coiled-coil, zinc-finger, metal-binding; 1.40A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2dgc_A Protein (GCN4); basic domain, leucine zipper, DNA binding, eukaryotic regulatory protein, transcription/DNA complex; HET: DNA; 2.20A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1dgc_A* 1ld4_E 1ysa_C* 3p8m_D | Back alignment and structure |
|---|
| >2j5u_A MREC protein; bacterial cell shape determining protein MREC, cell shape regulation; 2.5A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3m48_A General control protein GCN4; leucine zipper, synthetic peptide, alpha helix, activa amino-acid biosynthesis, DNA-binding, nucleus; 1.45A {Synthetic} PDB: 3i1g_A 2ahp_A* 2o7h_A | Back alignment and structure |
|---|
| >3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} | Back alignment and structure |
|---|
| >2no2_A HIP-I, huntingtin-interacting protein 1; clathrin light chain binding, HIP1 coiled-coil domain, endocytosis, clathrin SELF-assembly, cell adhesion; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1ses_A Seryl-tRNA synthetase; ligase; HET: AHX AMP; 2.50A {Thermus thermophilus} SCOP: a.2.7.1 d.104.1.1 PDB: 1ser_A* 1set_A* 1sry_A | Back alignment and structure |
|---|
| >1wt6_A Myotonin-protein kinase; coiled-coil, kinase activation, DMPK, molecular replacement, transferase; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1nlw_A MAD protein, MAX dimerizer; transcription factor, DNA, BHLHZ, transcription/DNA complex; 2.00A {Homo sapiens} SCOP: a.38.1.1 | Back alignment and structure |
|---|
| >1uix_A RHO-associated kinase; coiled-coil, transferase; HET: MSE; 1.80A {Bos taurus} SCOP: h.1.27.1 | Back alignment and structure |
|---|
| >1l8d_A DNA double-strand break repair RAD50 ATPase; zinc finger, DNA repair, recombination, HOOK motif, replication; HET: DNA CIT; 2.20A {Pyrococcus furiosus} SCOP: h.4.12.1 | Back alignment and structure |
|---|
| >3c3f_A Alpha/beta peptide with the GCN4-PLI SIDE chain S AN (alpha-alpha-alpha-beta) backbone...; helix bundle, foldamer, unknown function, de novo protein; HET: B3K B3D B3E BIL B3L BAL; 2.00A {Synthetic} SCOP: h.1.3.1 | Back alignment and structure |
|---|
| >1x8y_A Lamin A/C; structural protein, intermediate filament protein; 2.20A {Homo sapiens} SCOP: h.1.20.1 PDB: 3v5b_A 3v4w_A 3v4q_A | Back alignment and structure |
|---|
| >3htk_A Structural maintenance of chromosomes protein 5; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1gk4_A Vimentin; intermediate filament, dimer, parallel coiled coil, heptad repeat, stutter; 2.3A {Homo sapiens} SCOP: h.1.20.1 | Back alignment and structure |
|---|
| >2wq1_A General control protein GCN4; TAA, nucleus, coiled coil, DNA-binding, protein export, ION coordination, polar core residues; 1.08A {Saccharomyces cerevisiae} PDB: 2wq0_A 2wq2_A 2wq3_A 2wpz_A 2wpy_A 1ij0_A 1ij1_A 1gcm_A 1rb5_A 1rb6_A 1rb1_A 1rb4_A 1swi_A 3k7z_A 1zii_A 1zij_A 1ij2_A 1ij3_A 1zil_A 1zim_A ... | Back alignment and structure |
|---|
| >4f3l_B BMAL1B; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} | Back alignment and structure |
|---|
| >2v4h_A NF-kappa-B essential modulator; transcription, metal-binding, NEMO - IKK gamma - NFKB pathwa darpin, transcription regulation; 2.9A {Mus musculus} | Back alignment and structure |
|---|
| >1gu4_A CAAT/enhancer binding protein beta; transcription/DNA, protein-DNA complex, transcription factor, BZIP, C/EBP; 1.80A {Homo sapiens} SCOP: h.1.3.1 PDB: 1gtw_A 1gu5_A 1h88_A 1h8a_A 1io4_A 2e43_A* 2e42_A* 1h89_A 1ci6_B 1nwq_A | Back alignment and structure |
|---|
| >3swk_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1kd8_B GABH BLL, GCN4 acid base heterodimer base-D12LA16L; coiled coil heterodimer, de novo protein; 1.90A {Synthetic} SCOP: h.1.3.1 PDB: 1kd9_B 1kdd_B | Back alignment and structure |
|---|
| >3iv1_A Tumor susceptibility gene 101 protein; coiled_COIL, tumorigenesis, CELL_cycle regulation, alternative splicing, cell cycle, cell division; HET: MSE; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1uii_A Geminin; human, DNA replication, cell cycle; 2.00A {Homo sapiens} SCOP: h.1.28.1 | Back alignment and structure |
|---|
| >1wlq_A Geminin; coiled-coil; 2.80A {Mus musculus} PDB: 2zxx_A* | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >3trt_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural protein; 2.30A {Homo sapiens} PDB: 3klt_A* | Back alignment and structure |
|---|
| >1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1 | Back alignment and structure |
|---|
| >4h22_A Leucine-rich repeat flightless-interacting protei; nucleic acid sensor, transcription; 2.89A {Homo sapiens} | Back alignment and structure |
|---|
| >2wt7_B Transcription factor MAFB; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 2wty_A* 1k1v_A | Back alignment and structure |
|---|
| >2xv5_A Lamin-A/C; structural protein, intermediate filaments, nuclear membrane LEFT-handed coiled coil, right-handed coiled coil; HET: MSE; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2bni_A General control protein GCN4; four helix bundle, antiparallel four helix bundle acyl transferase; HET: TYZ; 1.5A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 2ccn_A 1w5k_A* 2ccf_A 2cce_A 1w5j_A* 1uo2_A 1gcl_A 1uo1_A 1unv_A 1uo0_A 1unt_A 1uo5_A 1unz_A 1unx_A 1unu_A 1unw_A 1uo4_A 1uo3_A 1uny_A 1u9f_A* ... | Back alignment and structure |
|---|
| >1jcd_A Major outer membrane lipoprotein; protein folding, coiled coil, helix capping, alanine-zipper, membrane protein; 1.30A {Escherichia coli} SCOP: h.1.16.1 PDB: 1eq7_A 1t8z_A* 2guv_A 2gus_A 1jcc_A 1kfn_A 1kfm_A | Back alignment and structure |
|---|
| >2eqb_B RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 2.70A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >1uo4_A General control protein GCN4; four helix bundle, cavity, iodobenzene; 1.70A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1uo3_A 1unt_A 1uo5_A 1unu_A 1unv_A 1uo1_A 2ccf_A 2cce_A 1unx_A 1unw_A 1w5j_A* 1w5k_A* 1u9f_A* 3f86_A* 3f87_A* 3hez_A* 3c3f_A* | Back alignment and structure |
|---|
| >4h22_A Leucine-rich repeat flightless-interacting protei; nucleic acid sensor, transcription; 2.89A {Homo sapiens} | Back alignment and structure |
|---|
| >1dh3_A Transcription factor CREB; protein-DNA complex, transcription/DNA complex; HET: DNA; 3.00A {Mus musculus} SCOP: h.1.3.1 | Back alignment and structure |
|---|
| >2w83_C C-JUN-amino-terminal kinase-interacting protein 4; golgi apparatus, protein transport, ER-golgi transport, ARF, GTPase, effector, myristate; HET: GTP; 1.93A {Homo sapiens} | Back alignment and structure |
|---|
| >1ik9_A DNA repair protein XRCC4; DNA END joining, double-strand break repair, V(D)J recombination, protein-protein complex, coiled coil; HET: DNA; 2.30A {Homo sapiens} SCOP: b.59.1.1 h.1.11.1 PDB: 3ii6_A* 1fu1_A* 3rwr_A* | Back alignment and structure |
|---|
| >1kd8_A GABH AIV, GCN4 acid base heterodimer acid-D12IA16V; coiled coil heterodimer, de novo protein; 1.90A {Synthetic} SCOP: h.1.3.1 PDB: 1kdd_A 1kd9_A | Back alignment and structure |
|---|
| >3w03_C DNA repair protein XRCC4; coiled-coil, NHEJ, DSBS repair, KU70/80, DNA-PKCS, DNA ligas binding protein; HET: DNA; 8.49A {Homo sapiens} | Back alignment and structure |
|---|
| >1a93_B MAX protein, coiled coil, LZ; leucine zipper, 2D solution structure, H-bonds, buried salt bridge, proto-oncogene, nuclear protein; NMR {Mus musculus} SCOP: h.1.3.1 PDB: 2a93_B | Back alignment and structure |
|---|
| >3oa7_A Head morphogenesis protein, chaotic nuclear migra protein 67 fusion protein; coiled coils, structural protein, spindle POLE BODY; 2.30A {Bacillus phage PHI29} | Back alignment and structure |
|---|
| >3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A | Back alignment and structure |
|---|
| >1lwu_C Fibrinogen gamma chain; heterotrimer, protein-peptide complex, blood clotting; HET: NDG MAN NAG BMA GAL; 2.80A {Petromyzon marinus} SCOP: d.171.1.1 h.1.8.1 PDB: 1n73_C* | Back alignment and structure |
|---|
| >3efg_A Protein SLYX homolog; xanthomonas campestris PV. campestris, coiled-coil, structur genomics, PSI-2, protein structure initiative; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >2zxx_A Geminin; coiled-coil, cell cycle, coiled coil, DNA replication inhibitor, phosphoprotein, DNA-binding, nucleus, proto-oncogene; HET: DNA; 2.80A {Mus musculus} | Back alignment and structure |
|---|
| >4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1gk4_A Vimentin; intermediate filament, dimer, parallel coiled coil, heptad repeat, stutter; 2.3A {Homo sapiens} SCOP: h.1.20.1 | Back alignment and structure |
|---|
| >2hy6_A General control protein GCN4; protein design, parallel heptamer, protein structure, biosyn protein; 1.25A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 2nrn_A 3crp_A 2b1f_A 3crp_B 2ipz_A 3ck4_A 3ck4_B 2b22_A 1ce9_A | Back alignment and structure |
|---|
| >4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2zxx_A Geminin; coiled-coil, cell cycle, coiled coil, DNA replication inhibitor, phosphoprotein, DNA-binding, nucleus, proto-oncogene; HET: DNA; 2.80A {Mus musculus} | Back alignment and structure |
|---|
| >3ibp_A Chromosome partition protein MUKB; structural maintenance of chromosomes, SMC, condensin, chromosome segregation, hinge, dimerization domain; 3.10A {Escherichia coli} | Back alignment and structure |
|---|
| >2ve7_A Kinetochore protein HEC1, kinetochore protein SPC; mitosis, centromere, cell cycle, microtubule, C division, calponin homology; 2.88A {Homo sapiens} PDB: 3iz0_C* | Back alignment and structure |
|---|
| >1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1 | Back alignment and structure |
|---|
| >2wg5_A General control protein GCN4, proteasome-activating nucleotidase; transcription hydrolase complex, nucleotide-binding; 2.10A {Saccharomyces cerevisiae} PDB: 2wg6_A | Back alignment and structure |
|---|
| >2zvf_A Alanyl-tRNA synthetase; C-terminal, oligomerization domain, aminoacyl-tRNA synthetase, ATP-binding, cytoplasm, ligase, nucleotide-binding; 3.20A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2xdj_A Uncharacterized protein YBGF; unknown function; 1.82A {Escherichia coli} PDB: 2wz7_A | Back alignment and structure |
|---|
| >3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1s1c_X RHO-associated, coiled-coil containing protein kinase 1; GTPase, RHO kinase, ROCK, signaling protein; HET: GNP; 2.60A {Homo sapiens} SCOP: h.1.27.1 | Back alignment and structure |
|---|
| >2dq3_A Seryl-tRNA synthetase; coiled-coil, homodimer, structural genomics, NPPSFA, nationa on protein structural and functional analyses; HET: SSA; 3.00A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1nkp_A C-MYC, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 | Back alignment and structure |
|---|
| >3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* | Back alignment and structure |
|---|
| >2xdj_A Uncharacterized protein YBGF; unknown function; 1.82A {Escherichia coli} PDB: 2wz7_A | Back alignment and structure |
|---|
| >2v4h_A NF-kappa-B essential modulator; transcription, metal-binding, NEMO - IKK gamma - NFKB pathwa darpin, transcription regulation; 2.9A {Mus musculus} | Back alignment and structure |
|---|
| >3he4_B Synzip5; heterodimeric coiled-coil, de novo protein; 2.46A {Artificial gene} | Back alignment and structure |
|---|
| >1l8d_A DNA double-strand break repair RAD50 ATPase; zinc finger, DNA repair, recombination, HOOK motif, replication; HET: DNA CIT; 2.20A {Pyrococcus furiosus} SCOP: h.4.12.1 | Back alignment and structure |
|---|
| >3u06_A Protein claret segregational; motor domain, stalk rotation, power stroke, kinesin-14, MICR binding, NCD, transport, molecular motor; HET: ADP GOL; 2.35A {Drosophila melanogaster} PDB: 2ncd_A* 1n6m_A* 1cz7_A* 3l1c_A* | Back alignment and structure |
|---|
| >4dzn_A Coiled-coil peptide CC-PIL; de novo protein; HET: PHI; 1.59A {Synthetic} PDB: 4dzm_A* 4dzl_A* 4dzk_A 1u0i_A 1u0i_B | Back alignment and structure |
|---|
| >3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4aj5_1 SKA3, spindle and kinetochore-associated protein 3; cell cycle, SKA complex, mitosis, cell division, kinetochore microtubule attachment; 3.32A {Homo sapiens} | Back alignment and structure |
|---|
| >3rrk_A V-type ATPase 116 kDa subunit; alpha beta fold, proton pump, subunit I/A, V-ATPase, proton; HET: NHE; 2.64A {Meiothermus ruber} | Back alignment and structure |
|---|
| >1dip_A Delta-sleep-inducing peptide immunoreactive peptide; structure, leucine zipper, PIG, acetylation; NMR {Sus scrofa} SCOP: h.1.12.1 | Back alignment and structure |
|---|
| >3m48_A General control protein GCN4; leucine zipper, synthetic peptide, alpha helix, activa amino-acid biosynthesis, DNA-binding, nucleus; 1.45A {Synthetic} PDB: 3i1g_A 2ahp_A* 2o7h_A | Back alignment and structure |
|---|
| >2zqm_A Prefoldin beta subunit 1; chaperone; HET: CIT; 1.90A {Thermococcus SP} PDB: 2zdi_A | Back alignment and structure |
|---|
| >3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} | Back alignment and structure |
|---|
| >3nmd_A CGMP dependent protein kinase; leucine zipper, coiled-coil, structural genomics, berkeley S genomics center, BSGC, dimerization; HET: MSE; 2.27A {Homo sapiens} | Back alignment and structure |
|---|
| >1wt6_A Myotonin-protein kinase; coiled-coil, kinase activation, DMPK, molecular replacement, transferase; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3lss_A Seryl-tRNA synthetase; aminoacyl-tRNA synthetase, tRNA ligase, AARS, serrs, translation, ATP-binding, nucleotide-binding, structural genomics; HET: ATP; 1.95A {Trypanosoma brucei} PDB: 3lsq_A* | Back alignment and structure |
|---|
| >3lss_A Seryl-tRNA synthetase; aminoacyl-tRNA synthetase, tRNA ligase, AARS, serrs, translation, ATP-binding, nucleotide-binding, structural genomics; HET: ATP; 1.95A {Trypanosoma brucei} PDB: 3lsq_A* | Back alignment and structure |
|---|
| >3rrk_A V-type ATPase 116 kDa subunit; alpha beta fold, proton pump, subunit I/A, V-ATPase, proton; HET: NHE; 2.64A {Meiothermus ruber} | Back alignment and structure |
|---|
| >3ni0_A Bone marrow stromal antigen 2; coiled-coil, antiviral defense, immune system, GPI anchor; 1.60A {Mus musculus} | Back alignment and structure |
|---|
| >2zqm_A Prefoldin beta subunit 1; chaperone; HET: CIT; 1.90A {Thermococcus SP} PDB: 2zdi_A | Back alignment and structure |
|---|
| >3a7o_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2wvr_A Geminin; DNA replication license, DNA replication inhibitor, phosphoprotein, UBL conjugation, DNA-binding, polymorphism; HET: DNA; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2wvr_A Geminin; DNA replication license, DNA replication inhibitor, phosphoprotein, UBL conjugation, DNA-binding, polymorphism; HET: DNA; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4aj5_K Spindle and kinetochore-associated protein 2; cell cycle, SKA complex, mitosis, cell division, kinetochore microtubule attachment; 3.32A {Homo sapiens} | Back alignment and structure |
|---|
| >1uii_A Geminin; human, DNA replication, cell cycle; 2.00A {Homo sapiens} SCOP: h.1.28.1 | Back alignment and structure |
|---|
| >1kd8_B GABH BLL, GCN4 acid base heterodimer base-D12LA16L; coiled coil heterodimer, de novo protein; 1.90A {Synthetic} SCOP: h.1.3.1 PDB: 1kd9_B 1kdd_B | Back alignment and structure |
|---|
| >1kd8_A GABH AIV, GCN4 acid base heterodimer acid-D12IA16V; coiled coil heterodimer, de novo protein; 1.90A {Synthetic} SCOP: h.1.3.1 PDB: 1kdd_A 1kd9_A | Back alignment and structure |
|---|
| >2ve7_C Kinetochore protein NUF2, kinetochore protein SPC; mitosis, centromere, cell cycle, microtubule, C division, calponin homology; 2.88A {Homo sapiens} PDB: 3iz0_D* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 136 | ||||
| d1nkpb_ | 83 | a.38.1.1 (B:) Max protein {Human (Homo sapiens) [T | 6e-09 | |
| d1nkpa_ | 88 | a.38.1.1 (A:) Myc proto-oncogene protein {Human (H | 7e-07 | |
| d1am9a_ | 80 | a.38.1.1 (A:) SREBP-1a {Human (Homo sapiens) [TaxI | 3e-06 | |
| d1uklc_ | 61 | a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId | 8e-06 | |
| d1nlwa_ | 79 | a.38.1.1 (A:) Mad protein {Human (Homo sapiens) [T | 5e-05 | |
| d1a5za2 | 172 | d.162.1.1 (A:164-333) Lactate dehydrogenase {Therm | 0.003 |
| >d1nkpb_ a.38.1.1 (B:) Max protein {Human (Homo sapiens) [TaxId: 9606]} Length = 83 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: HLH-like superfamily: HLH, helix-loop-helix DNA-binding domain family: HLH, helix-loop-helix DNA-binding domain domain: Max protein species: Human (Homo sapiens) [TaxId: 9606]
Score = 47.6 bits (113), Expect = 6e-09
Identities = 10/55 (18%), Positives = 23/55 (41%)
Query: 1 MLEPGRPPKTDKATILSDVVRMMEQLRTEAQKLKQSTEDLQEKIKELKAEKNELR 55
+ + K +A IL ++ +R + +Q +DL+ + L+ + L
Sbjct: 27 SVPSLQGEKASRAQILDKATEYIQYMRRKNHTHQQDIDDLKRQNALLEQQVRALG 81
|
| >d1nkpa_ a.38.1.1 (A:) Myc proto-oncogene protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
| >d1am9a_ a.38.1.1 (A:) SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} Length = 80 | Back information, alignment and structure |
|---|
| >d1uklc_ a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 61 | Back information, alignment and structure |
|---|
| >d1nlwa_ a.38.1.1 (A:) Mad protein {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d1a5za2 d.162.1.1 (A:164-333) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Length = 172 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 136 | |||
| d1uklc_ | 61 | SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} | 98.84 | |
| d1am9a_ | 80 | SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} | 98.56 | |
| d1nkpb_ | 83 | Max protein {Human (Homo sapiens) [TaxId: 9606]} | 98.37 | |
| d1nkpa_ | 88 | Myc proto-oncogene protein {Human (Homo sapiens) [ | 98.36 | |
| d1nlwa_ | 79 | Mad protein {Human (Homo sapiens) [TaxId: 9606]} | 98.33 | |
| d1a0aa_ | 63 | Pho4 B/HLH domain {Baker's yeast (Saccharomyces ce | 96.52 | |
| d1mdya_ | 68 | Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10 | 95.83 | |
| d1an4a_ | 65 | Usf B/HLH domain {Human (Homo sapiens) [TaxId: 960 | 95.2 | |
| d1seta1 | 110 | Seryl-tRNA synthetase (SerRS) {Thermus thermophilu | 93.75 | |
| d1seta1 | 110 | Seryl-tRNA synthetase (SerRS) {Thermus thermophilu | 88.42 | |
| d1nkpa_ | 88 | Myc proto-oncogene protein {Human (Homo sapiens) [ | 88.11 | |
| d1fxkc_ | 133 | Prefoldin alpha subunit {Archaeon Methanobacterium | 86.97 | |
| d1ivsa1 | 66 | Valyl-tRNA synthetase (ValRS) C-terminal domain {T | 85.88 | |
| d2p90a1 | 269 | Hypothetical protein Cgl1923 {Corynebacterium glut | 84.94 | |
| d1nkpb_ | 83 | Max protein {Human (Homo sapiens) [TaxId: 9606]} | 82.68 |
| >d1uklc_ a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: HLH-like superfamily: HLH, helix-loop-helix DNA-binding domain family: HLH, helix-loop-helix DNA-binding domain domain: SREBP-2 species: Human (Homo sapiens) [TaxId: 9606]
Probab=98.84 E-value=2.8e-09 Score=68.45 Aligned_cols=42 Identities=21% Similarity=0.286 Sum_probs=37.2
Q ss_pred CCCCCCCchhhhHHHHHHHHHHHHHHHHHHHHhhHHHHHHHH
Q 032672 4 PGRPPKTDKATILSDVVRMMEQLRTEAQKLKQSTEDLQEKIK 45 (136)
Q Consensus 4 P~rp~K~DKAsIL~DAir~lkqLr~e~~~Lk~~n~~L~ee~~ 45 (136)
|+-.+|+|||+||.+||.||++|+.+++.|++++..|+.+.+
T Consensus 16 P~~~~K~~Ka~iL~~Ai~YI~~Lq~~~~~L~~e~~~L~~~~~ 57 (61)
T d1uklc_ 16 MGTDAKMHKSGVLRKAIDYIKYLQQVNHKLRQENMVLKLANQ 57 (61)
T ss_dssp SCSSCCCCTTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred CCCCCcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 554479999999999999999999999999999998887654
|
| >d1am9a_ a.38.1.1 (A:) SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nkpb_ a.38.1.1 (B:) Max protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nkpa_ a.38.1.1 (A:) Myc proto-oncogene protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nlwa_ a.38.1.1 (A:) Mad protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a0aa_ a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1mdya_ a.38.1.1 (A:) Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1an4a_ a.38.1.1 (A:) Usf B/HLH domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1seta1 a.2.7.1 (A:1-110) Seryl-tRNA synthetase (SerRS) {Thermus thermophilus, strain hb27 [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1seta1 a.2.7.1 (A:1-110) Seryl-tRNA synthetase (SerRS) {Thermus thermophilus, strain hb27 [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1nkpa_ a.38.1.1 (A:) Myc proto-oncogene protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fxkc_ a.2.5.1 (C:) Prefoldin alpha subunit {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1ivsa1 a.2.7.3 (A:797-862) Valyl-tRNA synthetase (ValRS) C-terminal domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2p90a1 c.56.8.1 (A:6-274) Hypothetical protein Cgl1923 {Corynebacterium glutamicum [TaxId: 1718]} | Back information, alignment and structure |
|---|
| >d1nkpb_ a.38.1.1 (B:) Max protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|