Citrus Sinensis ID: 032672


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130------
MLEPGRPPKTDKATILSDVVRMMEQLRTEAQKLKQSTEDLQEKIKELKAEKNELRDEKQRLKADKEKLEQQVKAMSAPSGFLPHPSSMSAAFAAQSQVASNKLVPFIGYPGVAMWQFMPPAAVDTSQDHVLRPPVA
cccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccc
*****R*PKTDKATILSDVVRMMEQLRTEA********************************************************************ASNKLVPFIGYPGVAMWQFMPPA****SQ****RPP**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLEPGRPPKTDKATIxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxMSAPSGFLPHPSSMSAAFAAQSQVASNKLVPFIGYPGVAMWQFMPPAAVDTSQDHVLRPPVA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Transcription factor ILR3 Transcription factor. Plays a role in resistance to amide-linked indole-3-acetic acid (IAA) conjugates such as IAA-Leu and IAA-Phe. May regulates gene expression in response to metal homeostasis changes.probableQ9FH37

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2DFS, chain A
Confidence level:very confident
Coverage over the Query: 55-75
View the alignment between query and template
View the model in PyMOL
Template: 3I00, chain A
Confidence level:confident
Coverage over the Query: 9-75
View the alignment between query and template
View the model in PyMOL