Citrus Sinensis ID: 032691


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-----
MAAITASVGTSSITRSVLVHKPSIVASSSPVLGLPAMAVKGKVRCSMEEKPSKQESKTNVGMSASLLAAACAATMSSPAMALVDERMSTEGTGLPFGLSNNLLGWILLGVFGLIWALYIPYASSLDEDEESGLSL
cccEEEccccHHHHHHHHccccccccccccccccccHHcccccEEEEccccccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccc
********GTSSITRSVLVH**********************************************LAAACAATMSSPAMALVDERMSTEGTGLPFGLSNNLLGWILLGVFGLIWALYIPYAS************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAAITASVGTSSITRSVLVHKPSIVASSSPVLGLPAMAVKGKVRCSMEEKPSKQESKTNVGMSASLLAAACAATMSSPAMALVDERMSTEGTGLPFGLSNNLLGWILLGVFGLIWALYIPYASSLDEDEESGLSL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Photosystem II reaction center W protein, chloroplastic Stabilizes dimeric photosytem II (PSII). In its absence not dimeric PSII accumulates and there is a reduction of monomeric PSII.probableQ41387
Photosystem II reaction center W protein, chloroplastic Stabilizes dimeric photosytem II (PSII). In its absence no dimeric PSII accumulates and there is a reduction of monomeric PSII.probableQ39194
Photosystem II reaction center W protein, chloroplastic Stabilizes dimeric photosytem II (PSII). In its absence no dimeric PSII accumulates and there is a reduction of monomeric PSII.probableQ5ZBY9

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

No confident structure templates for the query are predicted