Citrus Sinensis ID: 032760


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130----
MADKAVTIRTRKFMTNRLLSRKQFVIDVLHPGRANVSKAELKEKLARMYDVKDPNSIFVFKFRTHFGGGKSTGFGLIYDSVDSAKKFEPKYRLIRNGLDTKVEKSRKQMKERKNRAKKIRGVKKTKASDAAKKK
cccccEEEEEcccccccccccEEEEEEEEccccccccHHHHHHHHHHHcccccccEEEEEcEEEcccccCEEEEEEEcccHHHHHHccccHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccc
***KAVTIRTRKFMTNRLLSRKQFVIDVLHPGRANVSKAELKEKLARMYDVKDPNSIFVFKFRTHFGGGKSTGFGLIYDSVDSAKKFEPKYRLIRN**************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MADKAVTIRTRKFMTNRLLSRKQFVIDVLHPGRANVSKAELKEKLARMYDVKDPNSIFVFKFRTHFGGGKSTGFGLIYDSVDSAKKFEPKYRLIRNGLDTKVEKSRKQMKERKNRAKKIRGVKKTKASDAAKKK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
40S ribosomal protein S24-1 confidentQ9SS17
40S ribosomal protein S24-2 confidentQ8LC83
40S ribosomal protein S24 Required for processing of pre-rRNA and maturation of 40S ribosomal subunits.probableP62849

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3IZ6, chain U
Confidence level:very confident
Coverage over the Query: 5-98
View the alignment between query and template
View the model in PyMOL