Citrus Sinensis ID: 032767


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130----
MGLSSKTRPGKFPSLLFPIEIKNIHKSKHGSDSGVYDSEGRFVPSKFEEIFTKHACTQPNALTSDELMGMLKANREPKDYGGWVAAYSEWKILYVLCKDKNGLLRKDTVRAVYDGSLFEHMEKEHESAKKKAAV
ccccccccccccccccccEEEccccccccccccccccccccccHHcHHHHHHHHcccccccccHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHcccccccHHHHHHHccccHHHHHHHHHHHHHHHccc
*GLSSKTRPGKFPSLLFPIEIKNIHKSKHGSDSGVYDSEGRFVPSKFEEIFTKHACTQPNALTSDELMGMLKANREPKDYGGWVAAYSEWKILYVLCKDKNGLLRKDTVRAVYDGSLFE***************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGLSSKTRPGKFPSLLFPIEIKNIHKSKHGSDSGVYDSEGRFVPSKFEEIFTKHACTQPNALTSDELMGMLKANREPKDYGGWVAAYSEWKILYVLCKDKNGLLRKDTVRAVYDGSLFEHMEKEHESAKKKAAV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable peroxygenase 4 Calcium-binding peroxygenase involved in the degradation of storage lipid in oil bodies. May be involved in the interaction between oil bodies and vacuoles during seed germination (By similarity). Acts as a negative regulator of abscisic acid responses in non-seed tissues.probableQ9CAB7

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1RRO, chain A
Confidence level:confident
Coverage over the Query: 43-113
View the alignment between query and template
View the model in PyMOL