Citrus Sinensis ID: 032767
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 134 | ||||||
| 224101875 | 199 | predicted protein [Populus trichocarpa] | 0.985 | 0.663 | 0.810 | 4e-59 | |
| 224108295 | 199 | predicted protein [Populus trichocarpa] | 0.985 | 0.663 | 0.803 | 1e-58 | |
| 351720983 | 202 | uncharacterized protein LOC100306686 [Gl | 0.970 | 0.643 | 0.792 | 1e-55 | |
| 358347258 | 197 | hypothetical protein MTR_097s0019 [Medic | 0.970 | 0.659 | 0.776 | 8e-55 | |
| 225424355 | 205 | PREDICTED: uncharacterized protein LOC10 | 0.985 | 0.643 | 0.772 | 9e-55 | |
| 449449236 | 198 | PREDICTED: probable peroxygenase 4-like | 0.977 | 0.661 | 0.755 | 1e-52 | |
| 255570045 | 198 | calcium ion binding protein, putative [R | 0.895 | 0.606 | 0.775 | 3e-51 | |
| 358248574 | 204 | uncharacterized protein LOC100799842 [Gl | 0.962 | 0.632 | 0.713 | 1e-49 | |
| 356530780 | 201 | PREDICTED: uncharacterized protein LOC10 | 0.970 | 0.646 | 0.7 | 2e-47 | |
| 297838881 | 195 | hypothetical protein ARALYDRAFT_894884 [ | 0.947 | 0.651 | 0.716 | 7e-47 |
| >gi|224101875|ref|XP_002312455.1| predicted protein [Populus trichocarpa] gi|222852275|gb|EEE89822.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 232 bits (591), Expect = 4e-59, Method: Compositional matrix adjust.
Identities = 107/132 (81%), Positives = 120/132 (90%)
Query: 1 MGLSSKTRPGKFPSLLFPIEIKNIHKSKHGSDSGVYDSEGRFVPSKFEEIFTKHACTQPN 60
+ LS KTRPGKFPS LFPIE+KNIH++KHGSDSGVYDSEGRFVP KFEEIF+KHA + PN
Sbjct: 68 IALSQKTRPGKFPSPLFPIEVKNIHRTKHGSDSGVYDSEGRFVPGKFEEIFSKHARSHPN 127
Query: 61 ALTSDELMGMLKANREPKDYGGWVAAYSEWKILYVLCKDKNGLLRKDTVRAVYDGSLFEH 120
+LT+DELMGMLKANREPKD+ GWVA+Y+EWKILY LCKDKNGLL +DT+RA YDGSLFEH
Sbjct: 128 SLTADELMGMLKANREPKDFRGWVASYTEWKILYDLCKDKNGLLHEDTIRAAYDGSLFEH 187
Query: 121 MEKEHESAKKKA 132
MEKE SAKKKA
Sbjct: 188 MEKERTSAKKKA 199
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224108295|ref|XP_002314792.1| predicted protein [Populus trichocarpa] gi|222863832|gb|EEF00963.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|351720983|ref|NP_001238730.1| uncharacterized protein LOC100306686 [Glycine max] gi|255629275|gb|ACU14982.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|358347258|ref|XP_003637676.1| hypothetical protein MTR_097s0019 [Medicago truncatula] gi|355503611|gb|AES84814.1| hypothetical protein MTR_097s0019 [Medicago truncatula] gi|388493300|gb|AFK34716.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|225424355|ref|XP_002284889.1| PREDICTED: uncharacterized protein LOC100242160 isoform 2 [Vitis vinifera] gi|297737641|emb|CBI26842.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449449236|ref|XP_004142371.1| PREDICTED: probable peroxygenase 4-like [Cucumis sativus] gi|449492721|ref|XP_004159081.1| PREDICTED: probable peroxygenase 4-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|255570045|ref|XP_002525985.1| calcium ion binding protein, putative [Ricinus communis] gi|223534717|gb|EEF36409.1| calcium ion binding protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|358248574|ref|NP_001240160.1| uncharacterized protein LOC100799842 [Glycine max] gi|255640517|gb|ACU20544.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356530780|ref|XP_003533958.1| PREDICTED: uncharacterized protein LOC100800915 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|297838881|ref|XP_002887322.1| hypothetical protein ARALYDRAFT_894884 [Arabidopsis lyrata subsp. lyrata] gi|297333163|gb|EFH63581.1| hypothetical protein ARALYDRAFT_894884 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 134 | ||||||
| TAIR|locus:2033632 | 195 | CLO4 "AT1G70670" [Arabidopsis | 0.880 | 0.605 | 0.728 | 1e-43 | |
| TAIR|locus:2033625 | 192 | AT1G70680 "AT1G70680" [Arabido | 0.880 | 0.614 | 0.669 | 1.9e-37 | |
| TAIR|locus:2028105 | 210 | AT1G23240 "AT1G23240" [Arabido | 0.880 | 0.561 | 0.635 | 6.3e-37 | |
| TAIR|locus:2116427 | 245 | ATS1 "AT4G26740" [Arabidopsis | 0.865 | 0.473 | 0.525 | 8.2e-28 | |
| TAIR|locus:2161655 | 243 | ATPXG2 "AT5G55240" [Arabidopsi | 0.880 | 0.485 | 0.491 | 2.8e-27 | |
| TAIR|locus:2028095 | 205 | AT1G23250 "AT1G23250" [Arabido | 0.858 | 0.560 | 0.542 | 4.5e-27 | |
| TAIR|locus:2051129 | 236 | RD20 "AT2G33380" [Arabidopsis | 0.880 | 0.5 | 0.466 | 7.6e-25 | |
| UNIPROTKB|G4N8T9 | 249 | MGG_10107 "Caleosin domain-con | 0.850 | 0.457 | 0.478 | 1.4e-23 | |
| TAIR|locus:1005716867 | 220 | AT5G29560 "AT5G29560" [Arabido | 0.455 | 0.277 | 0.524 | 2.3e-22 | |
| ASPGD|ASPL0000073305 | 378 | AN8591 [Emericella nidulans (t | 0.783 | 0.277 | 0.462 | 1.9e-20 |
| TAIR|locus:2033632 CLO4 "AT1G70670" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 461 (167.3 bits), Expect = 1.0e-43, P = 1.0e-43
Identities = 86/118 (72%), Positives = 100/118 (84%)
Query: 1 MGLSSKTRPGKFPSLLFPIEIKNIHKSKHGSDSGVYDSEGRFVPSKFEEIFTKHACTQPN 60
+GLSSKTRPGK S+ FPIE+KNIH +KHGSDSGVYD +GRFV SKFEEIFTKHA T +
Sbjct: 62 IGLSSKTRPGKGFSIWFPIEVKNIHLAKHGSDSGVYDKDGRFVASKFEEIFTKHAHTHRD 121
Query: 61 ALTSDELMGMLKANREPKDYGGWVAAYSEWKILYVLCKDKNGLLRKDTVRAVYDGSLF 118
ALT++EL +LKAN+EP D GW+A Y+EWK+L+ LCKDKNGLL KDTVRA YDGSLF
Sbjct: 122 ALTNEELKQLLKANKEPNDRKGWLAGYTEWKVLHYLCKDKNGLLHKDTVRAAYDGSLF 179
|
|
| TAIR|locus:2033625 AT1G70680 "AT1G70680" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2028105 AT1G23240 "AT1G23240" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2116427 ATS1 "AT4G26740" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2161655 ATPXG2 "AT5G55240" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2028095 AT1G23250 "AT1G23250" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2051129 RD20 "AT2G33380" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G4N8T9 MGG_10107 "Caleosin domain-containing protein" [Magnaporthe oryzae 70-15 (taxid:242507)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:1005716867 AT5G29560 "AT5G29560" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| ASPGD|ASPL0000073305 AN8591 [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| estExt_fgenesh4_pg.C_LG_VIII1184 | hypothetical protein (199 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 134 | |||
| pfam05042 | 174 | pfam05042, Caleosin, Caleosin related protein | 3e-71 |
| >gnl|CDD|113799 pfam05042, Caleosin, Caleosin related protein | Back alignment and domain information |
|---|
Score = 210 bits (537), Expect = 3e-71
Identities = 75/123 (60%), Positives = 90/123 (73%)
Query: 1 MGLSSKTRPGKFPSLLFPIEIKNIHKSKHGSDSGVYDSEGRFVPSKFEEIFTKHACTQPN 60
+GLS T PG PS LFPI IKNIHK+KHGSDSGVYD+EGRFVP FEEIF+K+A T P+
Sbjct: 52 LGLSYPTLPGWGPSPLFPIYIKNIHKAKHGSDSGVYDTEGRFVPVNFEEIFSKYARTHPD 111
Query: 61 ALTSDELMGMLKANREPKDYGGWVAAYSEWKILYVLCKDKNGLLRKDTVRAVYDGSLFEH 120
ALT EL M +ANR+ D GW+A+ EW +LY L KD+ G L K+ VR +DGSLFE
Sbjct: 112 ALTLGELWVMTEANRDALDPFGWLASKGEWGLLYTLAKDEEGFLSKEAVRRCFDGSLFEK 171
Query: 121 MEK 123
+ K
Sbjct: 172 LAK 174
|
This family contains plant proteins related to caleosin. Caleosins contain calcium-binding domains and have an oleosin-like association with lipid bodies. Caleosins are present at relatively low levels and are mainly bound to microsomal membrane fractions at the early stages of seed development. As the seeds mature, overall levels of caleosins increased dramatically and they were associated almost exclusively with storage lipid bodies. This family is probably related to EF hands pfam00036. Length = 174 |
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 134 | |||
| PF05042 | 174 | Caleosin: Caleosin related protein; InterPro: IPR0 | 100.0 | |
| PF13499 | 66 | EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A | 95.06 | |
| cd00051 | 63 | EFh EF-hand, calcium binding motif; A diverse supe | 94.56 | |
| PF13405 | 31 | EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J | 94.01 | |
| PF01023 | 44 | S_100: S-100/ICaBP type calcium binding domain; In | 93.74 | |
| PF00036 | 29 | EF-hand_1: EF hand; InterPro: IPR018248 Many calci | 93.3 | |
| smart00054 | 29 | EFh EF-hand, calcium binding motif. EF-hands are c | 91.95 | |
| cd05024 | 91 | S-100A10 S-100A10: A subgroup of the S-100A10 doma | 88.79 | |
| PTZ00184 | 149 | calmodulin; Provisional | 88.12 | |
| smart00027 | 96 | EH Eps15 homology domain. Pair of EF hand motifs t | 87.37 | |
| cd00052 | 67 | EH Eps15 homology domain; found in proteins implic | 86.88 | |
| PTZ00183 | 158 | centrin; Provisional | 83.66 | |
| PTZ00183 | 158 | centrin; Provisional | 83.57 | |
| PF13833 | 54 | EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A | 83.44 | |
| PF13202 | 25 | EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ | 83.12 | |
| PTZ00184 | 149 | calmodulin; Provisional | 82.52 | |
| cd05025 | 92 | S-100A1 S-100A1: S-100A1 domain found in proteins | 82.44 | |
| cd05022 | 89 | S-100A13 S-100A13: S-100A13 domain found in protei | 81.06 | |
| KOG0027 | 151 | consensus Calmodulin and related proteins (EF-Hand | 80.29 | |
| cd05023 | 89 | S-100A11 S-100A11: S-100A11 domain found in protei | 80.14 |
| >PF05042 Caleosin: Caleosin related protein; InterPro: IPR007736 This family contains plant proteins related to caleosin | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.2e-72 Score=444.04 Aligned_cols=123 Identities=59% Similarity=0.932 Sum_probs=121.3
Q ss_pred CCCCCCCCCCCCCCCccceeeccccccCCCCCCcccCCCCccChhhHHHHHhhhcCCCCCCCCHHHHHHHHHhcCCCCCc
Q 032767 1 MGLSSKTRPGKFPSLLFPIEIKNIHKSKHGSDSGVYDSEGRFVPSKFEEIFTKHACTQPNALTSDELMGMLKANREPKDY 80 (134)
Q Consensus 1 ~~lSy~T~~~w~P~p~f~Iyv~nIHk~kHGSDSg~YD~eGRFvp~kFE~iFsKya~~~~d~LT~~E~~~m~~~nR~~~D~ 80 (134)
++|||+|+|+|+|||+|||||+||||+|||||||+||+||||||+|||+||+|||+++||+||++||++|++||||++||
T Consensus 52 ~~lSy~T~~~w~p~P~f~Iyi~nIhk~kHGSDSg~YD~eGrFvp~kFe~iF~kya~~~~d~LT~~E~~~m~~~nr~~~D~ 131 (174)
T PF05042_consen 52 GALSYPTQPSWIPDPFFRIYIKNIHKGKHGSDSGAYDTEGRFVPQKFEEIFSKYAKTGPDALTLRELWRMLKGNRNANDP 131 (174)
T ss_pred cccCCccCCCCCCCCceeEEeecccccccCCCccccccCCcCCHHHHHHHHHHhCCCCCCCcCHHHHHHHHHhccccCCc
Confidence 47999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred chhhHHHhhHHHHHHhhhcCCCccchhhhhhcccCchHHHHHH
Q 032767 81 GGWVAAYSEWKILYVLCKDKNGLLRKDTVRAVYDGSLFEHMEK 123 (134)
Q Consensus 81 ~GW~aa~~EW~~~y~L~~d~dG~l~Ke~vR~vYDGSlF~~i~~ 123 (134)
+||+|+.+||.++|+|+||+||+|+||+||+|||||||++||+
T Consensus 132 ~GW~a~~~EW~~~y~L~~d~dG~l~Ke~iR~vYDGSlF~~iak 174 (174)
T PF05042_consen 132 FGWFAAFFEWGALYILAKDKDGFLSKEDIRGVYDGSLFYKIAK 174 (174)
T ss_pred chhhhhhhHHHHHHHHHcCcCCcEeHHHHhhhcchHHHHHhhC
Confidence 9999999999999999999999999999999999999999985
|
Caleosins contain calcium-binding domains and have an oleosin-like association with lipid bodies. Caleosins are present at relatively low levels and are mainly bound to microsomal membrane fractions at the early stages of seed development. As the seeds mature, overall levels of caleosins increased dramatically and they were associated almost exclusively with storage lipid bodies []. The calcium binding domain is probably related to the calcium-binding EF-hands motif IPR002048 from INTERPRO. |
| >PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E | Back alignment and domain information |
|---|
| >cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands | Back alignment and domain information |
|---|
| >PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B | Back alignment and domain information |
|---|
| >PF01023 S_100: S-100/ICaBP type calcium binding domain; InterPro: IPR013787 The calcium-binding domain found in S100 and CaBP-9k proteins is a subfamily of the EF-hand calcium-binding domain [] | Back alignment and domain information |
|---|
| >PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand | Back alignment and domain information |
|---|
| >smart00054 EFh EF-hand, calcium binding motif | Back alignment and domain information |
|---|
| >cd05024 S-100A10 S-100A10: A subgroup of the S-100A10 domain found in proteins similar to S100A10 | Back alignment and domain information |
|---|
| >PTZ00184 calmodulin; Provisional | Back alignment and domain information |
|---|
| >smart00027 EH Eps15 homology domain | Back alignment and domain information |
|---|
| >cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction | Back alignment and domain information |
|---|
| >PTZ00183 centrin; Provisional | Back alignment and domain information |
|---|
| >PTZ00183 centrin; Provisional | Back alignment and domain information |
|---|
| >PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A | Back alignment and domain information |
|---|
| >PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A | Back alignment and domain information |
|---|
| >PTZ00184 calmodulin; Provisional | Back alignment and domain information |
|---|
| >cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1 | Back alignment and domain information |
|---|
| >cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 | Back alignment and domain information |
|---|
| >KOG0027 consensus Calmodulin and related proteins (EF-Hand superfamily) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11 | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
No hit with e-value below 0.005
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 134 | |||
| 3li6_A | 66 | Calcium-binding protein; calcium signaling protein | 96.01 | |
| 1k9u_A | 78 | Polcalcin PHL P 7; pollen allergen, calcium-bindin | 95.49 | |
| 1tiz_A | 67 | Calmodulin-related protein, putative; helix-turn-h | 95.41 | |
| 3ox6_A | 153 | Calcium-binding protein 1; EF-hand, calcium-sensor | 95.01 | |
| 1rro_A | 108 | RAT oncomodulin; calcium-binding protein; 1.30A {R | 94.74 | |
| 3fs7_A | 109 | Parvalbumin, thymic; calcium-binding protein, EF-h | 94.65 | |
| 2kgr_A | 111 | Intersectin-1; structure, alternative splicing, ca | 94.55 | |
| 3j04_B | 143 | Myosin regulatory light chain 2, smooth muscle MA | 94.48 | |
| 1gjy_A | 167 | Sorcin, CP-22, V19; calcium binding, calcium-bindi | 94.47 | |
| 1k94_A | 165 | Grancalcin; penta-EF-hand protein, calcium binding | 94.38 | |
| 1avs_A | 90 | Troponin C; muscle contraction, calcium-activated, | 94.33 | |
| 3ll8_B | 155 | Calcineurin subunit B type 1; protein-peptide dock | 94.32 | |
| 2opo_A | 86 | Polcalcin CHE A 3; calcium-binding protein, dimer, | 94.16 | |
| 4ds7_A | 147 | Calmodulin, CAM; protein binding, metal binding, s | 94.15 | |
| 1dtl_A | 161 | Cardiac troponin C; helix-turn-helix, structural p | 94.13 | |
| 5pal_A | 109 | Parvalbumin; calcium-binding protein; 1.54A {Triak | 94.08 | |
| 1rwy_A | 109 | Parvalbumin alpha; EF-hand, calcium-binding, calci | 94.04 | |
| 1c07_A | 95 | Protein (epidermal growth factor receptor pathway | 93.97 | |
| 2kz2_A | 94 | Calmodulin, CAM; TR2C, metal binding protein; NMR | 93.81 | |
| 2pvb_A | 108 | Protein (parvalbumin); calcium binding protein, me | 93.8 | |
| 2pvb_A | 108 | Protein (parvalbumin); calcium binding protein, me | 93.75 | |
| 3e3r_A | 204 | Calcyphosin, calcyphosine; human calcyphosine, EF- | 93.74 | |
| 2b1u_A | 71 | Calmodulin-like protein 5; CLSP, calmodulin-like S | 93.71 | |
| 1jfj_A | 134 | Ehcabp, calcium-binding protein; EF-hand, helix-lo | 93.7 | |
| 1y1x_A | 191 | Leishmania major homolog of programmed cell death | 93.62 | |
| 3fwb_A | 161 | Cell division control protein 31; gene gating, com | 93.62 | |
| 1jfj_A | 134 | Ehcabp, calcium-binding protein; EF-hand, helix-lo | 93.53 | |
| 2bec_A | 202 | Calcineurin B homologous protein 2; calcineurin-ho | 93.49 | |
| 2joj_A | 77 | Centrin protein; N-terminal domain, centrin soluti | 93.49 | |
| 1qx2_A | 76 | Vitamin D-dependent calcium-binding protein, INTE; | 93.47 | |
| 2mys_B | 166 | Myosin; muscle protein, motor protein; HET: MLY; 2 | 93.44 | |
| 3mse_B | 180 | Calcium-dependent protein kinase, putative; CDPKS, | 93.36 | |
| 1exr_A | 148 | Calmodulin; high resolution, disorder, metal trans | 93.33 | |
| 2jnf_A | 158 | Troponin C; stretch activated muscle contraction, | 93.32 | |
| 2f2o_A | 179 | Calmodulin fused with calmodulin-binding domain of | 93.3 | |
| 2pmy_A | 91 | RAS and EF-hand domain-containing protein; rasef, | 93.28 | |
| 1alv_A | 173 | Calpain, S-camld; calcium binding, calmodulin like | 93.24 | |
| 2bl0_C | 142 | Myosin regulatory light chain; muscle protein, sli | 93.24 | |
| 3akb_A | 166 | Putative calcium binding protein; EF-hand, metal b | 93.23 | |
| 1qls_A | 99 | S100C protein, calgizzarin; metal-binding protein/ | 93.22 | |
| 2mys_C | 149 | Myosin; muscle protein, motor protein; HET: MLY; 2 | 93.15 | |
| 2kyc_A | 108 | Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p | 93.08 | |
| 2ktg_A | 85 | Calmodulin, putative; ehcam, Ca-binding protein, p | 93.06 | |
| 1juo_A | 198 | Sorcin; calcium-binding proteins, penta-EF-hand, P | 93.05 | |
| 2znd_A | 172 | Programmed cell death protein 6; penta-EF-hand pro | 93.04 | |
| 1snl_A | 103 | Nucleobindin 1, calnuc; EF-hand, calcium-binding, | 93.04 | |
| 1nya_A | 176 | Calerythrin; EF-hand, metal binding protein; NMR { | 93.03 | |
| 1pva_A | 110 | Parvalbumin; calcium binding; 1.65A {Esox lucius} | 93.03 | |
| 2f2o_A | 179 | Calmodulin fused with calmodulin-binding domain of | 93.01 | |
| 3sjs_A | 220 | URE3-BP sequence specific DNA binding protein; EF- | 92.98 | |
| 5pal_A | 109 | Parvalbumin; calcium-binding protein; 1.54A {Triak | 92.88 | |
| 2r2i_A | 198 | Guanylyl cyclase-activating protein 1; EF hand, GC | 92.82 | |
| 1rwy_A | 109 | Parvalbumin alpha; EF-hand, calcium-binding, calci | 92.72 | |
| 1s6c_A | 183 | KV4 potassium channel-interacting protein kchip1B; | 92.7 | |
| 3akb_A | 166 | Putative calcium binding protein; EF-hand, metal b | 92.69 | |
| 1cb1_A | 78 | Calbindin D9K; calcium-binding protein; NMR {Sus s | 92.68 | |
| 3khe_A | 191 | Calmodulin-like domain protein kinase isoform 3; c | 92.67 | |
| 1fi6_A | 92 | EH domain protein REPS1; EPS15 homology domain, EF | 92.66 | |
| 3qrx_A | 169 | Centrin; calcium-binding, EF-hand, cell division, | 92.66 | |
| 1j7q_A | 86 | CAVP, calcium vector protein; EF-hand family, calc | 92.58 | |
| 1bu3_A | 109 | Calcium-binding protein; 1.65A {Merluccius bilinea | 92.57 | |
| 2ct9_A | 208 | Calcium-binding protein P22; EF-hand, metal bindin | 92.56 | |
| 3fia_A | 121 | Intersectin-1; EH 1 domain, NESG, structural genom | 92.51 | |
| 2qac_A | 146 | Myosin A tail domain interacting protein MTIP; mal | 92.48 | |
| 1rro_A | 108 | RAT oncomodulin; calcium-binding protein; 1.30A {R | 92.47 | |
| 1k8u_A | 90 | S100A6, calcyclin, CACY; calcium regulatory protei | 92.47 | |
| 1yx7_A | 83 | Calsensin, LAN3-6 antigen; calcium-binding protein | 92.42 | |
| 4ds7_A | 147 | Calmodulin, CAM; protein binding, metal binding, s | 92.33 | |
| 3fwb_A | 161 | Cell division control protein 31; gene gating, com | 92.33 | |
| 1bu3_A | 109 | Calcium-binding protein; 1.65A {Merluccius bilinea | 92.29 | |
| 1g8i_A | 190 | Frequenin, neuronal calcium sensor 1; calcium bind | 92.28 | |
| 1qjt_A | 99 | EH1, epidermal growth factor receptor substrate su | 92.24 | |
| 2zfd_A | 226 | Calcineurin B-like protein 2; calcium binding prot | 92.19 | |
| 2kn2_A | 92 | Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco | 92.16 | |
| 2aao_A | 166 | CDPK, calcium-dependent protein kinase, isoform AK | 92.15 | |
| 2bl0_B | 145 | Myosin regulatory light chain; muscle protein, sli | 92.1 | |
| 2ggz_A | 211 | Guanylyl cyclase-activating protein 3; EF hand, gu | 92.08 | |
| 3qrx_A | 169 | Centrin; calcium-binding, EF-hand, cell division, | 92.05 | |
| 1pva_A | 110 | Parvalbumin; calcium binding; 1.65A {Esox lucius} | 92.04 | |
| 3dd4_A | 229 | KV channel-interacting protein 4; EF-hands protein | 92.04 | |
| 1top_A | 162 | Troponin C; contractIle system protein; 1.78A {Gal | 92.01 | |
| 3e3r_A | 204 | Calcyphosin, calcyphosine; human calcyphosine, EF- | 91.98 | |
| 3ox6_A | 153 | Calcium-binding protein 1; EF-hand, calcium-sensor | 91.95 | |
| 1k94_A | 165 | Grancalcin; penta-EF-hand protein, calcium binding | 91.92 | |
| 1jba_A | 204 | GCAP-2, protein (guanylate cyclase activating prot | 91.83 | |
| 2obh_A | 143 | Centrin-2; DNA repair complex EF hand superfamily | 91.71 | |
| 2ehb_A | 207 | Calcineurin B-like protein 4; protein complex, Ca( | 91.67 | |
| 1q80_A | 174 | SCP, sarcoplasmic calcium-binding protein; all-alp | 91.61 | |
| 1s6c_A | 183 | KV4 potassium channel-interacting protein kchip1B; | 91.61 | |
| 1s6i_A | 188 | CDPK, calcium-dependent protein kinase SK5; EF-han | 91.6 | |
| 2l4h_A | 214 | Calcium and integrin-binding protein 1; metal bind | 91.59 | |
| 1dgu_A | 183 | Calcium-saturated CIB; helical, EF-hands, blood cl | 91.58 | |
| 2d58_A | 107 | Allograft inflammatory factor 1; EF-hand, metal bi | 91.55 | |
| 3i5g_B | 153 | Myosin regulatory light chain LC-2, mantle muscle; | 91.53 | |
| 2i7a_A | 174 | Calpain 13; calcium-dependent cytoplasmic cysteine | 91.47 | |
| 1k2h_A | 93 | S100A1, S-100 protein, alpha chain; non-covalent h | 91.45 | |
| 1dtl_A | 161 | Cardiac troponin C; helix-turn-helix, structural p | 91.42 | |
| 2jul_A | 256 | Calsenilin; EF-hand, calcium, LXXLL, DNA binding p | 91.39 | |
| 1bjf_A | 193 | Neurocalcin delta; calcium-binding, myristoylation | 91.39 | |
| 3khe_A | 191 | Calmodulin-like domain protein kinase isoform 3; c | 91.33 | |
| 1s1e_A | 224 | KV channel interacting protein 1; kchip, calcium-b | 91.33 | |
| 1exr_A | 148 | Calmodulin; high resolution, disorder, metal trans | 91.31 | |
| 2ccm_A | 191 | Calexcitin; EF hand, calcium, signaling protein; 1 | 91.29 | |
| 3cs1_A | 219 | Flagellar calcium-binding protein; myristoylated, | 91.19 | |
| 2ccm_A | 191 | Calexcitin; EF hand, calcium, signaling protein; 1 | 91.16 | |
| 3ll8_B | 155 | Calcineurin subunit B type 1; protein-peptide dock | 91.15 | |
| 2l2e_A | 190 | Calcium-binding protein NCS-1; NCS1P, myristoylate | 91.13 | |
| 2aao_A | 166 | CDPK, calcium-dependent protein kinase, isoform AK | 91.1 | |
| 3k21_A | 191 | PFCDPK3, calcium-dependent protein kinase 3; calci | 91.0 | |
| 2jnf_A | 158 | Troponin C; stretch activated muscle contraction, | 90.98 | |
| 1fpw_A | 190 | Yeast frequenin, calcium-binding protein NCS-1; EF | 90.97 | |
| 2sas_A | 185 | Sarcoplasmic calcium-binding protein; 2.40A {Branc | 90.91 | |
| 1juo_A | 198 | Sorcin; calcium-binding proteins, penta-EF-hand, P | 90.76 | |
| 2mys_B | 166 | Myosin; muscle protein, motor protein; HET: MLY; 2 | 90.76 | |
| 2r2i_A | 198 | Guanylyl cyclase-activating protein 1; EF hand, GC | 90.7 | |
| 1gjy_A | 167 | Sorcin, CP-22, V19; calcium binding, calcium-bindi | 90.6 | |
| 3mwu_A | 486 | Calmodulin-domain protein kinase 1; serine/threoni | 90.55 | |
| 3fs7_A | 109 | Parvalbumin, thymic; calcium-binding protein, EF-h | 90.54 | |
| 1dgu_A | 183 | Calcium-saturated CIB; helical, EF-hands, blood cl | 90.42 | |
| 2bl0_C | 142 | Myosin regulatory light chain; muscle protein, sli | 90.39 | |
| 1bjf_A | 193 | Neurocalcin delta; calcium-binding, myristoylation | 90.38 | |
| 1m45_A | 148 | MLC1P, myosin light chain; protein-peptide complex | 90.38 | |
| 1nya_A | 176 | Calerythrin; EF-hand, metal binding protein; NMR { | 90.37 | |
| 2d8n_A | 207 | Recoverin; structural genomics, NPPSFA, national p | 90.33 | |
| 2lhi_A | 176 | Calmodulin, serine/threonine-protein phosphatase c | 90.26 | |
| 3h4s_E | 135 | KCBP interacting Ca2+-binding protein; kinesin, mo | 90.19 | |
| 1top_A | 162 | Troponin C; contractIle system protein; 1.78A {Gal | 90.13 | |
| 2lv7_A | 100 | Calcium-binding protein 7; metal binding protein; | 89.99 | |
| 1y1x_A | 191 | Leishmania major homolog of programmed cell death | 89.95 | |
| 1q80_A | 174 | SCP, sarcoplasmic calcium-binding protein; all-alp | 89.89 | |
| 2lmt_A | 148 | Calmodulin-related protein 97A; spermatogenesis, m | 89.8 | |
| 2l2e_A | 190 | Calcium-binding protein NCS-1; NCS1P, myristoylate | 89.76 | |
| 2ggz_A | 211 | Guanylyl cyclase-activating protein 3; EF hand, gu | 89.71 | |
| 1eh2_A | 106 | EPS15; calcium binding, signaling domain, NPF bind | 89.65 | |
| 2sas_A | 185 | Sarcoplasmic calcium-binding protein; 2.40A {Branc | 89.57 | |
| 1wlz_A | 105 | DJBP, CAP-binding protein complex interacting prot | 89.53 | |
| 1s6j_A | 87 | CDPK, calcium-dependent protein kinase SK5; EF-han | 89.5 | |
| 1s1e_A | 224 | KV channel interacting protein 1; kchip, calcium-b | 89.37 | |
| 3j04_B | 143 | Myosin regulatory light chain 2, smooth muscle MA | 89.36 | |
| 3nyv_A | 484 | Calmodulin-domain protein kinase 1; serine/threoni | 89.27 | |
| 2hpk_A | 208 | Photoprotein berovin; structural genomics, PSI, pr | 89.25 | |
| 1jba_A | 204 | GCAP-2, protein (guanylate cyclase activating prot | 89.16 | |
| 2ovk_C | 159 | Myosin catalytic light chain LC-1, mantle muscle, | 89.16 | |
| 3h4s_E | 135 | KCBP interacting Ca2+-binding protein; kinesin, mo | 89.13 | |
| 1alv_A | 173 | Calpain, S-camld; calcium binding, calmodulin like | 89.11 | |
| 1g8i_A | 190 | Frequenin, neuronal calcium sensor 1; calcium bind | 89.02 | |
| 3rm1_A | 92 | Protein S100-B; alpha-helical, EF hand, metal bind | 88.89 | |
| 3pm8_A | 197 | PFCDPK2, calcium-dependent protein kinase 2; malar | 88.85 | |
| 2mys_C | 149 | Myosin; muscle protein, motor protein; HET: MLY; 2 | 88.83 | |
| 1w7j_B | 151 | Myosin light chain 1; motor protein, unconventiona | 88.78 | |
| 2jjz_A | 150 | Ionized calcium-binding adapter molecule 2; EF-han | 88.67 | |
| 2obh_A | 143 | Centrin-2; DNA repair complex EF hand superfamily | 88.53 | |
| 1iq3_A | 110 | Ralbp1-interacting protein (partner of ralbp1); EF | 88.38 | |
| 1ggw_A | 140 | Protein (CDC4P); light chain, cytokinesis, cell cy | 88.3 | |
| 1uhk_A | 191 | Aequorin 2, aequorin; EF-hand motif, complex, lumi | 88.24 | |
| 3dd4_A | 229 | KV channel-interacting protein 4; EF-hands protein | 88.03 | |
| 1xk4_A | 93 | Calgranulin A; S100 family, heterotetramer, metal | 87.95 | |
| 3u0k_A | 440 | Rcamp; fluorescent protein, calcium binding, EF-ha | 87.93 | |
| 3pm8_A | 197 | PFCDPK2, calcium-dependent protein kinase 2; malar | 87.86 | |
| 2bl0_B | 145 | Myosin regulatory light chain; muscle protein, sli | 87.83 | |
| 1fpw_A | 190 | Yeast frequenin, calcium-binding protein NCS-1; EF | 87.68 | |
| 2znd_A | 172 | Programmed cell death protein 6; penta-EF-hand pro | 87.66 | |
| 3mse_B | 180 | Calcium-dependent protein kinase, putative; CDPKS, | 87.52 | |
| 1wdc_B | 156 | Scallop myosin; calcium binding protein, muscle pr | 87.46 | |
| 2hpk_A | 208 | Photoprotein berovin; structural genomics, PSI, pr | 87.44 | |
| 1wdc_B | 156 | Scallop myosin; calcium binding protein, muscle pr | 87.29 | |
| 2ovk_B | 153 | RLC, myosin regulatory light chain LC-2, mantle mu | 87.28 | |
| 2qac_A | 146 | Myosin A tail domain interacting protein MTIP; mal | 87.2 | |
| 2jq6_A | 139 | EH domain-containing protein 1; metal binding prot | 87.08 | |
| 3k21_A | 191 | PFCDPK3, calcium-dependent protein kinase 3; calci | 87.08 | |
| 3lij_A | 494 | Calcium/calmodulin dependent protein kinase with A | 86.88 | |
| 1wdc_C | 156 | Scallop myosin; calcium binding protein, muscle pr | 86.83 | |
| 1ggw_A | 140 | Protein (CDC4P); light chain, cytokinesis, cell cy | 86.75 | |
| 3dtp_E | 196 | RLC, myosin regulatory light chain; muscle protein | 86.6 | |
| 1wy9_A | 147 | Allograft inflammatory factor 1; EF-hand, calucium | 86.58 | |
| 2bec_A | 202 | Calcineurin B homologous protein 2; calcineurin-ho | 86.56 | |
| 2ct9_A | 208 | Calcium-binding protein P22; EF-hand, metal bindin | 86.55 | |
| 3q5i_A | 504 | Protein kinase; CDPK, malaria, phosphotransferase, | 86.47 | |
| 3sg6_A | 450 | Gcamp2, myosin light chain kinase, green fluoresce | 86.4 | |
| 1c7v_A | 81 | CAVP, calcium vector protein; EF-hand family, calc | 86.29 | |
| 2lhi_A | 176 | Calmodulin, serine/threonine-protein phosphatase c | 86.2 | |
| 3lij_A | 494 | Calcium/calmodulin dependent protein kinase with A | 86.16 | |
| 3a8r_A | 179 | Putative uncharacterized protein; EF-hand, membran | 86.14 | |
| 2lmt_A | 148 | Calmodulin-related protein 97A; spermatogenesis, m | 86.05 | |
| 1m45_A | 148 | MLC1P, myosin light chain; protein-peptide complex | 86.02 | |
| 2jul_A | 256 | Calsenilin; EF-hand, calcium, LXXLL, DNA binding p | 86.0 | |
| 1qv0_A | 195 | Obelin, OBL; photoprotein, bioluminescence, atomic | 85.83 | |
| 3bow_A | 714 | Calpain-2 catalytic subunit; cysteine protease, in | 85.7 | |
| 2l4h_A | 214 | Calcium and integrin-binding protein 1; metal bind | 85.56 | |
| 3dtp_E | 196 | RLC, myosin regulatory light chain; muscle protein | 85.56 | |
| 3sjs_A | 220 | URE3-BP sequence specific DNA binding protein; EF- | 85.49 | |
| 1uhk_A | 191 | Aequorin 2, aequorin; EF-hand motif, complex, lumi | 85.17 | |
| 2kyc_A | 108 | Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p | 85.01 | |
| 1qv0_A | 195 | Obelin, OBL; photoprotein, bioluminescence, atomic | 84.77 | |
| 1ij5_A | 323 | Plasmodial specific LAV1-2 protein; fourty kDa cal | 84.56 | |
| 3a4u_B | 143 | Multiple coagulation factor deficiency protein 2; | 84.39 | |
| 1s6i_A | 188 | CDPK, calcium-dependent protein kinase SK5; EF-han | 84.33 | |
| 2lvv_A | 226 | Flagellar calcium-binding protein TB-24; EF-hand, | 84.13 | |
| 1sjj_A | 863 | Actinin; 3-helix bundle, calponin homology domain, | 84.12 | |
| 2d8n_A | 207 | Recoverin; structural genomics, NPPSFA, national p | 83.95 | |
| 2ovk_B | 153 | RLC, myosin regulatory light chain LC-2, mantle mu | 83.77 | |
| 3nyv_A | 484 | Calmodulin-domain protein kinase 1; serine/threoni | 83.68 | |
| 2zfd_A | 226 | Calcineurin B-like protein 2; calcium binding prot | 83.29 | |
| 3q5i_A | 504 | Protein kinase; CDPK, malaria, phosphotransferase, | 83.01 | |
| 2ehb_A | 207 | Calcineurin B-like protein 4; protein complex, Ca( | 82.56 | |
| 1w7j_B | 151 | Myosin light chain 1; motor protein, unconventiona | 82.5 | |
| 2opo_A | 86 | Polcalcin CHE A 3; calcium-binding protein, dimer, | 81.94 | |
| 2f33_A | 263 | Calbindin; EF-hand, Ca2+-binding, metal binding pr | 81.84 | |
| 2kax_A | 92 | Protein S100-A5; EF-hand, calcium binding protien, | 81.46 | |
| 3li6_A | 66 | Calcium-binding protein; calcium signaling protein | 81.42 | |
| 2f33_A | 263 | Calbindin; EF-hand, Ca2+-binding, metal binding pr | 81.08 | |
| 1tiz_A | 67 | Calmodulin-related protein, putative; helix-turn-h | 80.96 | |
| 3nso_A | 101 | Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta | 80.72 | |
| 2ovk_C | 159 | Myosin catalytic light chain LC-1, mantle muscle, | 80.39 | |
| 2lnk_A | 113 | Protein S100-A4; EF-hand, calcium binding, all alp | 80.15 | |
| 3a4u_B | 143 | Multiple coagulation factor deficiency protein 2; | 80.09 |
| >3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} | Back alignment and structure |
|---|
Probab=96.01 E-value=0.016 Score=34.46 Aligned_cols=59 Identities=14% Similarity=0.280 Sum_probs=45.7
Q ss_pred HHHHhhhcCCCCCCCCHHHHHHHHHhcCCCCCcchhhHHHhhHHHHHHhh-hcCCCccchhhhhhcc
Q 032767 48 EEIFTKHACTQPNALTSDELMGMLKANREPKDYGGWVAAYSEWKILYVLC-KDKNGLLRKDTVRAVY 113 (134)
Q Consensus 48 E~iFsKya~~~~d~LT~~E~~~m~~~nR~~~D~~GW~aa~~EW~~~y~L~-~d~dG~l~Ke~vR~vY 113 (134)
.++|..++..+.+.||..|+..+++.- |-..+.-|+..++..+ .|.+|.++.++...++
T Consensus 3 ~~~F~~~D~d~~G~i~~~e~~~~l~~~-------~~~~~~~~~~~~~~~~D~~~~g~i~~~ef~~~~ 62 (66)
T 3li6_A 3 EALFKEIDVNGDGAVSYEEVKAFVSKK-------RAIKNEQLLQLIFKSIDADGNGEIDQNEFAKFY 62 (66)
T ss_dssp CHHHHHHCTTCSSSCCHHHHHHHHHHH-------HHHHHHHHHHHHHHHHCTTCSSSCCHHHHHHHH
T ss_pred HHHHHHHCCCCCCcccHHHHHHHHHHc-------cCCCcHHHHHHHHHHHCCCCCCCCCHHHHHHHH
Confidence 578999999988999999999999863 3334455666666666 6778999998887665
|
| >1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 | Back alignment and structure |
|---|
| >1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A | Back alignment and structure |
|---|
| >1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A | Back alignment and structure |
|---|
| >3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A | Back alignment and structure |
|---|
| >2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} | Back alignment and structure |
|---|
| >1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 | Back alignment and structure |
|---|
| >1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A | Back alignment and structure |
|---|
| >1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A | Back alignment and structure |
|---|
| >3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* | Back alignment and structure |
|---|
| >2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A | Back alignment and structure |
|---|
| >4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A | Back alignment and structure |
|---|
| >1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... | Back alignment and structure |
|---|
| >5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 | Back alignment and structure |
|---|
| >1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A | Back alignment and structure |
|---|
| >1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} | Back alignment and structure |
|---|
| >2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A | Back alignment and structure |
|---|
| >2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A | Back alignment and structure |
|---|
| >3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A | Back alignment and structure |
|---|
| >1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 | Back alignment and structure |
|---|
| >3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A | Back alignment and structure |
|---|
| >1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A | Back alignment and structure |
|---|
| >2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} | Back alignment and structure |
|---|
| >1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A | Back alignment and structure |
|---|
| >2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B | Back alignment and structure |
|---|
| >3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... | Back alignment and structure |
|---|
| >2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A | Back alignment and structure |
|---|
| >2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A | Back alignment and structure |
|---|
| >2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A | Back alignment and structure |
|---|
| >2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} | Back alignment and structure |
|---|
| >3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A | Back alignment and structure |
|---|
| >1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A | Back alignment and structure |
|---|
| >2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* | Back alignment and structure |
|---|
| >2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A | Back alignment and structure |
|---|
| >1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A | Back alignment and structure |
|---|
| >2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A | Back alignment and structure |
|---|
| >1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 | Back alignment and structure |
|---|
| >1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A | Back alignment and structure |
|---|
| >2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A | Back alignment and structure |
|---|
| >3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A | Back alignment and structure |
|---|
| >5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 | Back alignment and structure |
|---|
| >2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} | Back alignment and structure |
|---|
| >1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A | Back alignment and structure |
|---|
| >1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E | Back alignment and structure |
|---|
| >3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A | Back alignment and structure |
|---|
| >1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 | Back alignment and structure |
|---|
| >3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A | Back alignment and structure |
|---|
| >1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A | Back alignment and structure |
|---|
| >1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 | Back alignment and structure |
|---|
| >2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A | Back alignment and structure |
|---|
| >3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A | Back alignment and structure |
|---|
| >2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A | Back alignment and structure |
|---|
| >1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A | Back alignment and structure |
|---|
| >1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A | Back alignment and structure |
|---|
| >1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A | Back alignment and structure |
|---|
| >4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A | Back alignment and structure |
|---|
| >3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A | Back alignment and structure |
|---|
| >1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 | Back alignment and structure |
|---|
| >1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A | Back alignment and structure |
|---|
| >1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A | Back alignment and structure |
|---|
| >2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} | Back alignment and structure |
|---|
| >2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} | Back alignment and structure |
|---|
| >2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A | Back alignment and structure |
|---|
| >1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A | Back alignment and structure |
|---|
| >3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A | Back alignment and structure |
|---|
| >1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... | Back alignment and structure |
|---|
| >3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A | Back alignment and structure |
|---|
| >1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A | Back alignment and structure |
|---|
| >1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A | Back alignment and structure |
|---|
| >2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A | Back alignment and structure |
|---|
| >1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A | Back alignment and structure |
|---|
| >1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E | Back alignment and structure |
|---|
| >1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A | Back alignment and structure |
|---|
| >1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* | Back alignment and structure |
|---|
| >2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B | Back alignment and structure |
|---|
| >2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A | Back alignment and structure |
|---|
| >1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... | Back alignment and structure |
|---|
| >2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... | Back alignment and structure |
|---|
| >2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} | Back alignment and structure |
|---|
| >3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} | Back alignment and structure |
|---|
| >2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} | Back alignment and structure |
|---|
| >3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* | Back alignment and structure |
|---|
| >2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A | Back alignment and structure |
|---|
| >2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A | Back alignment and structure |
|---|
| >1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A | Back alignment and structure |
|---|
| >2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A | Back alignment and structure |
|---|
| >2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B | Back alignment and structure |
|---|
| >2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} | Back alignment and structure |
|---|
| >1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 | Back alignment and structure |
|---|
| >3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* | Back alignment and structure |
|---|
| >3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A | Back alignment and structure |
|---|
| >1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* | Back alignment and structure |
|---|
| >2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} | Back alignment and structure |
|---|
| >1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A | Back alignment and structure |
|---|
| >1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A | Back alignment and structure |
|---|
| >2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... | Back alignment and structure |
|---|
| >2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 | Back alignment and structure |
|---|
| >1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A | Back alignment and structure |
|---|
| >2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A | Back alignment and structure |
|---|
| >2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A | Back alignment and structure |
|---|
| >2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 | Back alignment and structure |
|---|
| >1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} | Back alignment and structure |
|---|
| >3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* | Back alignment and structure |
|---|
| >2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} | Back alignment and structure |
|---|
| >1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A | Back alignment and structure |
|---|
| >1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A | Back alignment and structure |
|---|
| >3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... | Back alignment and structure |
|---|
| >3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} | Back alignment and structure |
|---|
| >2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* | Back alignment and structure |
|---|
| >1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C | Back alignment and structure |
|---|
| >2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A | Back alignment and structure |
|---|
| >2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A | Back alignment and structure |
|---|
| >1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A | Back alignment and structure |
|---|
| >3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A | Back alignment and structure |
|---|
| >1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A | Back alignment and structure |
|---|
| >3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} | Back alignment and structure |
|---|
| >3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} | Back alignment and structure |
|---|
| >2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} | Back alignment and structure |
|---|
| >1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A | Back alignment and structure |
|---|
| >2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A | Back alignment and structure |
|---|
| >3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... | Back alignment and structure |
|---|
| >2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} | Back alignment and structure |
|---|
| >1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... | Back alignment and structure |
|---|
| >2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A | Back alignment and structure |
|---|
| >2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A | Back alignment and structure |
|---|
| >3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A | Back alignment and structure |
|---|
| >3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* | Back alignment and structure |
|---|
| >1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... | Back alignment and structure |
|---|
| >1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} | Back alignment and structure |
|---|
| >1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A | Back alignment and structure |
|---|
| >2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A | Back alignment and structure |
|---|
| >3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} | Back alignment and structure |
|---|
| >3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A | Back alignment and structure |
|---|
| >1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A | Back alignment and structure |
|---|
| >2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* | Back alignment and structure |
|---|
| >3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} | Back alignment and structure |
|---|
| >2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A | Back alignment and structure |
|---|
| >1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A | Back alignment and structure |
|---|
| >2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* | Back alignment and structure |
|---|
| >3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L | Back alignment and structure |
|---|
| >2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A | Back alignment and structure |
|---|
| >3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} | Back alignment and structure |
|---|
| >3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A | Back alignment and structure |
|---|
| >1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A | Back alignment and structure |
|---|
| >2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A | Back alignment and structure |
|---|
| >1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* | Back alignment and structure |
|---|
| >1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A | Back alignment and structure |
|---|
| >3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C | Back alignment and structure |
|---|
| >1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} | Back alignment and structure |
|---|
| >1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 | Back alignment and structure |
|---|
| >2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A | Back alignment and structure |
|---|
| >3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* | Back alignment and structure |
|---|
| >2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A | Back alignment and structure |
|---|
| >3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} | Back alignment and structure |
|---|
| >2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A | Back alignment and structure |
|---|
| >1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C | Back alignment and structure |
|---|
| >2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A | Back alignment and structure |
|---|
| >2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A | Back alignment and structure |
|---|
| >2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A | Back alignment and structure |
|---|
| >3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} | Back alignment and structure |
|---|
| >2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A | Back alignment and structure |
|---|
| >1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A | Back alignment and structure |
|---|
| >2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A | Back alignment and structure |
|---|
| >3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 134 | |||
| d1c07a_ | 95 | Eps15 {Human (Homo sapiens) [TaxId: 9606]} | 96.23 | |
| d1qjta_ | 99 | Eps15 {Mouse (Mus musculus) [TaxId: 10090]} | 94.97 | |
| d1jfja_ | 134 | EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: | 94.45 | |
| d2jxca1 | 95 | Eps15 {Human (Homo sapiens) [TaxId: 9606]} | 94.09 | |
| d1tiza_ | 67 | Calmodulin-related protein T21P5.17 {Thale cress ( | 94.04 | |
| d1fi6a_ | 92 | Reps1 {Mouse (Mus musculus) [TaxId: 10090]} | 94.02 | |
| d1iq3a_ | 110 | Pob1 {Human (Homo sapiens) [TaxId: 9606]} | 93.42 | |
| d2opoa1 | 81 | Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta | 93.29 | |
| d1k94a_ | 165 | Grancalcin {Human (Homo sapiens) [TaxId: 9606]} | 92.91 | |
| d1oqpa_ | 77 | Caltractin (centrin 2) {Green algae (Chlamydomonas | 92.65 | |
| d1fi5a_ | 81 | Troponin C {Chicken (Gallus gallus), cardiac isofo | 92.58 | |
| d1auib_ | 165 | Calcineurin regulatory subunit (B-chain) {Human (H | 92.47 | |
| d2zfda1 | 183 | Calcineurin B-like protein 2 {Thale cress (Arabido | 92.15 | |
| d2sasa_ | 185 | Sarcoplasmic calcium-binding protein {Amphioxus (B | 91.79 | |
| d1e8aa_ | 87 | Calcyclin (S100) {Human (Homo sapiens), calgranuli | 91.45 | |
| d1uhka1 | 187 | Calcium-regulated photoprotein {Jellyfish (Aequore | 91.35 | |
| d1xk4c1 | 83 | Calcyclin (S100) {Human (Homo sapiens), s100a9 (mr | 91.11 | |
| d1cb1a_ | 78 | Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} | 90.92 | |
| d1jc2a_ | 75 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 90.8 | |
| d1f54a_ | 77 | Calmodulin {Baker's yeast (Saccharomyces cerevisia | 90.38 | |
| d1topa_ | 162 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 90.37 | |
| d1jfja_ | 134 | EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: | 89.99 | |
| d1ksoa_ | 93 | Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta | 89.95 | |
| d1df0a1 | 186 | Calpain large subunit, C-terminal domain (domain I | 89.56 | |
| d1hqva_ | 181 | Apoptosis-linked protein alg-2 {Mouse (Mus musculu | 89.52 | |
| d1k8ua_ | 89 | Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta | 89.47 | |
| d1fw4a_ | 65 | Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | 89.37 | |
| d1snla_ | 99 | Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax | 89.19 | |
| d1alva_ | 173 | Calpain small (regulatory) subunit (domain VI) {Pi | 89.18 | |
| d1nyaa_ | 176 | Calerythrin {Saccharopolyspora erythraea [TaxId: 1 | 89.14 | |
| d1pvaa_ | 109 | Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | 88.82 | |
| d1qlsa_ | 95 | Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s1 | 88.55 | |
| d1xo5a_ | 180 | Calcium- and integrin-binding protein, CIB {Human | 88.46 | |
| d1exra_ | 146 | Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI | 88.35 | |
| d1rroa_ | 108 | Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 | 88.15 | |
| d1rwya_ | 109 | Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} | 88.11 | |
| d5pala_ | 109 | Parvalbumin {Leopard shark (Triakis semifasciata) | 88.11 | |
| d1avsa_ | 81 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 88.01 | |
| d3cr5x1 | 90 | Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: | 87.88 | |
| d2scpa_ | 174 | Sarcoplasmic calcium-binding protein {Sandworm (Ne | 87.75 | |
| d1k94a_ | 165 | Grancalcin {Human (Homo sapiens) [TaxId: 9606]} | 87.74 | |
| d1g8ia_ | 187 | Frequenin (neuronal calcium sensor 1) {Human (Homo | 87.46 | |
| d1exra_ | 146 | Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI | 86.9 | |
| d2scpa_ | 174 | Sarcoplasmic calcium-binding protein {Sandworm (Ne | 86.52 | |
| d1xo5a_ | 180 | Calcium- and integrin-binding protein, CIB {Human | 86.45 | |
| d1fpwa_ | 190 | Frequenin (neuronal calcium sensor 1) {Baker's yea | 86.22 | |
| d1lkja_ | 146 | Calmodulin {Baker's yeast (Saccharomyces cerevisia | 85.66 | |
| d1j55a_ | 94 | Calcyclin (S100) {Human (Homo sapiens), s100p [Tax | 85.64 | |
| d1fpwa_ | 190 | Frequenin (neuronal calcium sensor 1) {Baker's yea | 85.48 | |
| d1qx2a_ | 76 | Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} | 85.41 | |
| d2opoa1 | 81 | Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta | 84.55 | |
| d3c1va1 | 93 | Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta | 84.53 | |
| d1zfsa1 | 93 | Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 | 84.41 | |
| d1dtla_ | 156 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 84.09 | |
| d1bjfa_ | 181 | Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} | 83.53 | |
| d1jbaa_ | 189 | Guanylate cyclase activating protein 2, GCAP-2 {Co | 83.39 | |
| d1psra_ | 100 | Calcyclin (S100) {Human (Homo sapiens), psoriasin | 83.39 | |
| d2mysc_ | 145 | Myosin Regulatory Chain {Chicken (Gallus gallus) [ | 82.95 | |
| d1topa_ | 162 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 82.8 | |
| d1ggwa_ | 140 | Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ | 82.74 | |
| d1yuta1 | 98 | Calcyclin (S100) {Human (Homo sapiens), s100a13 [T | 81.9 | |
| d1a4pa_ | 92 | Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 | 81.77 | |
| d1qxpa2 | 188 | Calpain large subunit, C-terminal domain (domain I | 81.53 | |
| d1y1xa_ | 182 | Programmed cell death 6 protein-like protein {Leis | 81.31 | |
| d1fi5a_ | 81 | Troponin C {Chicken (Gallus gallus), cardiac isofo | 81.25 | |
| d1juoa_ | 172 | Sorcin {Human (Homo sapiens) [TaxId: 9606]} | 81.09 | |
| d1jc2a_ | 75 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 80.64 | |
| d1dtla_ | 156 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 80.2 | |
| d1auib_ | 165 | Calcineurin regulatory subunit (B-chain) {Human (H | 80.1 |
| >d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: EF Hand-like superfamily: EF-hand family: Eps15 homology domain (EH domain) domain: Eps15 species: Human (Homo sapiens) [TaxId: 9606]
Probab=96.23 E-value=0.0043 Score=40.57 Aligned_cols=56 Identities=21% Similarity=0.321 Sum_probs=45.3
Q ss_pred hhHHHHHhhhcCCCCCCCCHHHHHHHHHhcCCCCCcchhhHHHhhHHHHHHhh-hcCCCccchhhh
Q 032767 45 SKFEEIFTKHACTQPNALTSDELMGMLKANREPKDYGGWVAAYSEWKILYVLC-KDKNGLLRKDTV 109 (134)
Q Consensus 45 ~kFE~iFsKya~~~~d~LT~~E~~~m~~~nR~~~D~~GW~aa~~EW~~~y~L~-~d~dG~l~Ke~v 109 (134)
++|+++|.++++.+.+.||..|+..+++.... ..-+...+|.++ .|+||.|++++.
T Consensus 10 ~~~~~~F~~~D~d~~G~is~~e~~~~l~~~~l---------~~~~l~~i~~~~D~d~dG~l~~~EF 66 (95)
T d1c07a_ 10 AKYDEIFLKTDKDMDGFVSGLEVREIFLKTGL---------PSTLLAHIWSLCDTKDCGKLSKDQF 66 (95)
T ss_dssp HHHHHHHHHHCTTCSSEECHHHHHHHHHTTTC---------CHHHHHHHHHHHCTTCSSSEETTTH
T ss_pred HHHHHHHHHHCCCCCCCCcHHHHHHHHHhcCC---------CHHHHHHHHHHhCCCCCCeEcHHHH
Confidence 68999999999999899999999999976432 233555777777 567899999884
|
| >d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} | Back information, alignment and structure |
|---|
| >d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} | Back information, alignment and structure |
|---|
| >d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} | Back information, alignment and structure |
|---|
| >d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} | Back information, alignment and structure |
|---|
| >d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} | Back information, alignment and structure |
|---|
| >d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} | Back information, alignment and structure |
|---|
| >d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | Back information, alignment and structure |
|---|
| >d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} | Back information, alignment and structure |
|---|
| >d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} | Back information, alignment and structure |
|---|
| >d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} | Back information, alignment and structure |
|---|
| >d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} | Back information, alignment and structure |
|---|
| >d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} | Back information, alignment and structure |
|---|
| >d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} | Back information, alignment and structure |
|---|
| >d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|