Citrus Sinensis ID: 032800


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130---
MGRIFVVELDGRSYRCKFCRTHLALPEDLVSRAFHCRRGKAYLFNSAVNITVGASEERLMLSGMHTVADIFCCSCGQIVGWKYESAREKSQKYKEGKFVLERFIFLSHIVSSNFCKHWVHEESHNVVPAFLAV
cccEEEEEccccEEECcccccccccccccccccECcccccEEEEEEEEEcccccccEEEEccccEEEEcccccccccEEEEEEcccccccccccccEEEEEEccccccccccccccccccccccccccccccc
MGRIFVVELDGRSYRCKFCRTHLALPEDLVSRAFHCRRGKAYLFNSAVNITVGASEERLMLSGMHTVADIFCCSCGQIVGWKYESAREKSQKYKEGKFVLERFIFLSHIVSSNFCKHWVHEESHNVVPAF***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGRIFVVELDGRSYRCKFCRTHLALPEDLVSRAFHCRRGKAYLFNSAVNITVGASEERLMLSGMHTVADIFCCSCGQIVGWKYESAREKSQKYKEGKFVLERFIFLSHIVSSNFCKHWVHEESHNVVPAFLAV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein yippee-like At5g53940 confidentQ9FN32
Protein yippee-like 3 May be involved in proliferation and apoptosis in myeloid precursor cells.probableQ6NWI4
Protein yippee-like 2 probableQ2YDI3

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2K8D, chain A
Confidence level:confident
Coverage over the Query: 12-85
View the alignment between query and template
View the model in PyMOL
Template: 3EQT, chain A
Confidence level:probable
Coverage over the Query: 12-106
View the alignment between query and template
View the model in PyMOL