Citrus Sinensis ID: 032819

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130---

MAAASGSKVGPAIRRQALTLTESAAERLRQLLEQRQRPFLRLGVKARGCNGLSYTLNYADEKSKFDEVVEDKGVKILIDPKALMHVIGTKMDFVDDKLRSEFVFINPNSKGQCGCGESFMTTSSAEAAKRGRS

cccccccccccccccccccccHHHHHHHHHHHHHcccccEEEEEccccccccccccEEccccccccEEEEEccEEEEEccccccEEccEEEEEEEcccccccEEccccccccccccccEEccccHHHHHcccc

*****************LTLTESAAERLRQLLEQRQRPFLRLGVKARGCNGLSYTLNYADEKSKFDEVVEDKGVKILIDPKALMHVIGTKMDFVDDKLRSEFVFINPNSKGQCGCGESFM*************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MAAASGSKVGPAIRRQALTLTESAAERLRQLLEQRQRPFLRLGVKARGCNGLSYTLNYADEKSKFDEVVEDKGVKILIDPKALMHVIGTKMDFVDDKLRSEFVFINPNSKGQCGCGESFMTTSSAEAAKRGRS

Annotation	Function Description	Confidence Level	Reference Protein
Iron-sulfur assembly protein IscA-like 1, mitochondrial	Involved in the assembly of mitochondrial iron-sulfur proteins. Probably involved in the binding of an intermediate of Fe/S cluster assembly.	confident	Q8LBM4
Iron-sulfur cluster assembly 1 homolog, mitochondrial	Involved in the assembly of mitochondrial iron-sulfur proteins. Probably involved in the binding of an intermediate of Fe/S cluster assembly.	probable	Q9BUE6
Iron-sulfur cluster assembly 1 homolog, mitochondrial	Involved in the assembly of mitochondrial iron-sulfur proteins. Probably involved in the binding of an intermediate of Fe/S cluster assembly.	probable	Q80W96

No EC number assigned to the protein, probably not an enzyme!

Template: 1R94, chain A
Confidence level:very confident
Coverage over the Query: 16-111
View the alignment between query and template
View the model in PyMOL