Citrus Sinensis ID: 032857


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130--
MQAIECERTDGSAGGLSLMFRRWATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGMGKDHTLYALKEGRVKFEKHKLSGRKWVHVEPKEGHVLHPLYANATANASSPQLETAA
cccEEEEEcccccccEEEEEEEHHHcccccccccccccccccccEEECccEEECcccEEEEccccccccccccccccccEEEEEEccEEEEEECcccccEEEEEECcccccccccccccccccccccccccc
*************GGLSLMFRRW******************NLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGMGKDHTLYALKEGRVKFEKHKLSGRKWVHVEPKEGHVLHPLYA***************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQAIECERTDGSAGGLSLMFRRWATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGMGKDHTLYALKEGRVKFEKHKLSGRKWVHVEPKEGHVLHPLYANATANASSPQLETAA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
50S ribosomal protein L27 probableQ8DEC5
50S ribosomal protein L27 probableQ6LV48
50S ribosomal protein L27 probableB0UVI0

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3BBO, chain X
Confidence level:very confident
Coverage over the Query: 24-110
View the alignment between query and template
View the model in PyMOL