Citrus Sinensis ID: 032864


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130--
MATRLMFENSCEVGVFSKLTNAFCLVAIGGSESFYSTFEAELADVIPVVKTSIGGNRIIGRLCVGNKNGLLLPHTTTDQELQHLRNSLPDQVVVQRIEERLSALGNCIACNDHVALAHTDLDRVMLLLCVSS
ccEEEEEEccccEEEEEEEcccEEEEEccccHHHHHHHHHHHcccccEEEEEEcccCEEEEEEEEcccEEEEcccccHHHHHHHHHccccccEEEEEccccccccEEEEECccEEEEcccccccEEEEEEcc
*ATRLMFENSCEVGVFSKLTNAFCLVAIGGSESFYSTFEAELADVIPVVKTSIGGNRIIGRLCVGNKNGLLLPHTTTDQELQHLRNSLPDQVVVQRIEERLSALGNCIACNDHVALAHTDLDRVMLLLCVS*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATRLMFENSCEVGVFSKLTNAFCLVAIGGSESFYSTFEAELADVIPVVKTSIGGNRIIGRLCVGNKNGLLLPHTTTDQELQHLRNSLPDQVVVQRIEERLSALGNCIACNDHVALAHTDLDRVMLLLCVSS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Eukaryotic translation initiation factor 6 Binds to the 60S ribosomal subunit and prevents its association with the 40S ribosomal subunit to form the 80S initiation complex in the cytoplasm. May also be involved in ribosome biogenesis.probableP56538
Eukaryotic translation initiation factor 6 Binds to the 60S ribosomal subunit and prevents its association with the 40S ribosomal subunit to form the 80S initiation complex in the cytoplasm. May behave as a stimulatory translation initiation factor downstream insulin/growth factors. Is also involved in ribosome biogenesis. Associates with pre-60S subunits in the nucleus and is involved in its nuclear export. Cytoplasmic release of TIF6 from 60S subunits and nuclear relocalization is promoted by a RACK1 (GNB2L1)-dependent protein kinase C activity.probableQ3KRD8
Eukaryotic translation initiation factor 6 Binds to the 60S ribosomal subunit and prevents its association with the 40S ribosomal subunit to form the 80S initiation complex in the cytoplasm. May behave as a stimulatory translation initiation factor downstream insulin/growth factors. Is also involved in ribosome biogenesis. Associates with pre-60S subunits in the nucleus and is involved in its nuclear export. Cytoplasmic release of TIF6 from 60S subunits and nuclear relocalization is promoted by a RACK1 (GNB2L1)-dependent protein kinase C activity.probableP56537

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1G62, chain A
Confidence level:very confident
Coverage over the Query: 1-129
View the alignment between query and template
View the model in PyMOL