Citrus Sinensis ID: 032902

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130
MAQQSSAKEVDPEDVSKVIVFLKEVGASSSIPDDCCTNDSYSNILGRHIKVHKIQRGRLICHLSVKPAILNFFGGIHGGAIAAFSERMAIACARTVVAEDKEIFLGELGISYLSAAPHNWKKCDCGCSGV
cccccccccccHHHHHHHHHHHHHHcccccccccccccccHHHHHHccEEEEEEEccEEEEEEEccccccccccccHHHHHHHHHHHHHHHHHEEcccccccEEEEEEEEEEEcccccccEEcccccccc
cccccccccccHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHcHcccccccEEEEEEEcHHHHHHcccccHHHHHHHHHHHHHHHHHHHHccccccEHHHEEHHHHHcccHHccccccccccc
maqqssakevdpedVSKVIVFLKEvgasssipddcctndsysnILGRHIKVHKIQRGRLICHLSVKPAILNFFGGIHGGAIAAFSERMAIACARTVVAEDKEIFLGELGISylsaaphnwkkcdcgcsgv
maqqssakevdpedvSKVIVFLKEvgasssipddcCTNDSYSNILGRHIKVHKIQRGRLICHLSVKPAILNFFGGIHGGAIAAFSERMAIACARTVVAEDKEIFLGELGISylsaaphnwkkCDCGCSGV
MAQQSSAKEVDPEDVSKVIVFLKEVGASSSIPDDCCTNDSYSNILGRHIKVHKIQRGRLICHLSVKPAILNffggihggaiaafSERMAIACARTVVAEDKEIFLGELGISYLSAAPHNWKKCDCGCSGV
****************KVIVFLKEVGASSSIPDDCCTNDSYSNILGRHIKVHKIQRGRLICHLSVKPAILNFFGGIHGGAIAAFSERMAIACARTVVAEDKEIFLGELGISYLSAAPHNWKKCDCGC***
*********************LKE**************DSYSNILGRHIKVHKIQRGRLICHLSVKPAILNFFGGIHGGAIAAFSERMAIACARTVVAEDKEIFLGELGISYLSAAPHNWKKCDCGCS*V
*************DVSKVIVFLKEVGASSSIPDDCCTNDSYSNILGRHIKVHKIQRGRLICHLSVKPAILNFFGGIHGGAIAAFSERMAIACARTVVAEDKEIFLGELGISYLSAAPHNWKKCDCGCSGV
********EVDPEDVSKVIVFLKEVGASSSIPDDCCTNDSYSNILGRHIKVHKIQRGRLICHLSVKPAILNFFGGIHGGAIAAFSERMAIACARTVVAEDKEIFLGELGISYLSAAPHNWKKCDCGCS**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAQQSSAKEVDPEDVSKVIVFLKEVGASSSIPDDCCTNDSYSNILGRHIKVHKIQRGRLICHLSVKPAILNFFGGIHGGAIAAFSERMAIACARTVVAEDKEIFLGELGISYLSAAPHNWKKCDCGCSGV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query130
255541494180 acyl-CoA thioesterase, putative [Ricinus 0.807 0.583 0.6 7e-29
225453704178 PREDICTED: uncharacterized protein LOC10 0.853 0.623 0.522 7e-28
357514705187 hypothetical protein MTR_8g032450 [Medic 0.915 0.636 0.483 6e-26
388499806136 unknown [Lotus japonicus] 0.846 0.808 0.490 9e-25
225453706176 PREDICTED: uncharacterized protein LOC10 0.853 0.630 0.450 3e-24
224067856174 predicted protein [Populus trichocarpa] 0.861 0.643 0.508 4e-24
388496884182 unknown [Lotus japonicus] 0.869 0.620 0.469 3e-23
255541492184 acyl-CoA thioesterase, putative [Ricinus 0.907 0.641 0.467 5e-23
356504898177 PREDICTED: putative esterase F42H10.6-li 0.869 0.638 0.477 6e-23
225453708171 PREDICTED: acyl-coenzyme A thioesterase 0.853 0.649 0.495 8e-23
>gi|255541494|ref|XP_002511811.1| acyl-CoA thioesterase, putative [Ricinus communis] gi|223548991|gb|EEF50480.1| acyl-CoA thioesterase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  132 bits (331), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 63/105 (60%), Positives = 78/105 (74%)

Query: 15  VSKVIVFLKEVGASSSIPDDCCTNDSYSNILGRHIKVHKIQRGRLICHLSVKPAILNFFG 74
           V K+  F  +VG +S IP +  + D YSNIL   +K   +QRGR+ C  SV P + N+FG
Sbjct: 29  VDKIHGFFTDVGVTSCIPKNKQSEDFYSNILSNLLKADHVQRGRISCSFSVLPFVANYFG 88

Query: 75  GIHGGAIAAFSERMAIACARTVVAEDKEIFLGELGISYLSAAPHN 119
           G+HGGA+AA +ER+AIACARTVVAEDKEIFLGEL +SYLSAAP N
Sbjct: 89  GLHGGALAAIAERVAIACARTVVAEDKEIFLGELSLSYLSAAPKN 133

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225453704|ref|XP_002270956.1| PREDICTED: uncharacterized protein LOC100259154 [Vitis vinifera] gi|296089052|emb|CBI38755.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|357514705|ref|XP_003627641.1| hypothetical protein MTR_8g032450 [Medicago truncatula] gi|355521663|gb|AET02117.1| hypothetical protein MTR_8g032450 [Medicago truncatula] gi|388514581|gb|AFK45352.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|388499806|gb|AFK37969.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|225453706|ref|XP_002270993.1| PREDICTED: uncharacterized protein LOC100254026 [Vitis vinifera] gi|296089053|emb|CBI38756.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224067856|ref|XP_002302567.1| predicted protein [Populus trichocarpa] gi|222844293|gb|EEE81840.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|388496884|gb|AFK36508.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|255541492|ref|XP_002511810.1| acyl-CoA thioesterase, putative [Ricinus communis] gi|223548990|gb|EEF50479.1| acyl-CoA thioesterase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356504898|ref|XP_003521231.1| PREDICTED: putative esterase F42H10.6-like [Glycine max] Back     alignment and taxonomy information
>gi|225453708|ref|XP_002271066.1| PREDICTED: acyl-coenzyme A thioesterase 13 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query130
TAIR|locus:2098831188 AT3G61200 [Arabidopsis thalian 0.846 0.585 0.378 2e-15
TAIR|locus:2098831 AT3G61200 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 194 (73.4 bits), Expect = 2.0e-15, P = 2.0e-15
 Identities = 42/111 (37%), Positives = 63/111 (56%)

Query:     7 AKEVDPEDVSKVIVFLKEVGASSSIPDDCCTNDSYSNILGRHIKVHKIQRGRLICHLSVK 66
             +K +DP  V  V  F K +    S  +D  + DS+S +   + +   I RGR+ C ++V 
Sbjct:    30 SKVIDPNYVLMVADFFKAISPDESC-NDFTSFDSFSVLFQNNTRALSIARGRVSCSVTVT 88

Query:    67 PAILNXXXXXXXXXXXXXSERMAIACARTVVAEDKEIFLGELGISYLSAAP 117
             P I N             +ER+A+AC +TVV+EDK +F+GEL +SYLS+AP
Sbjct:    89 PGISNFFKGLHGGAVASIAERVAMACVKTVVSEDKHLFIGELSMSYLSSAP 139


Parameters:
  V=100
  filter=SEG
  E=0.001

  ctxfactor=1.00

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   +0      0   BLOSUM62        0.319   0.133   0.403    same    same    same
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a

  Query
  Frame  MatID  Length  Eff.Length     E     S W   T  X   E2     S2
   +0      0      130       117   0.00091  102 3  11 22  0.47    30
                                                     29  0.46    32


Statistics:

  Database:  /share/blast/go-seqdb.fasta
   Title:  go_20130330-seqdb.fasta
   Posted:  5:47:42 AM PDT Apr 1, 2013
   Created:  5:47:42 AM PDT Apr 1, 2013
   Format:  XDF-1
   # of letters in database:  169,044,731
   # of sequences in database:  368,745
   # of database sequences satisfying E:  1
  No. of states in DFA:  556 (59 KB)
  Total size of DFA:  129 KB (2083 KB)
  Time to generate neighborhood:  0.00u 0.00s 0.00t   Elapsed:  00:00:00
  No. of threads or processors used:  24
  Search cpu time:  10.75u 0.10s 10.85t   Elapsed:  00:00:01
  Total cpu time:  10.75u 0.10s 10.85t   Elapsed:  00:00:01
  Start:  Fri May 10 07:36:07 2013   End:  Fri May 10 07:36:08 2013
GO:0005634 "nucleus" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0016788 "hydrolase activity, acting on ester bonds" evidence=ISS
GO:0047617 "acyl-CoA hydrolase activity" evidence=ISS
GO:0005777 "peroxisome" evidence=IDA

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query130
cd03443113 cd03443, PaaI_thioesterase, PaaI_thioesterase is a 4e-10
cd03440100 cd03440, hot_dog, The hotdog fold was initially id 1e-04
COG2050141 COG2050, PaaI, HGG motif-containing thioesterase, 5e-04
>gnl|CDD|239527 cd03443, PaaI_thioesterase, PaaI_thioesterase is a tetrameric acyl-CoA thioesterase with a hot dog fold and one of several proteins responsible for phenylacetic acid (PA) degradation in bacteria Back     alignment and domain information 
 Score = 52.9 bits (128), Expect = 4e-10
 Identities = 21/70 (30%), Positives = 35/70 (50%)

Query: 48  HIKVHKIQRGRLICHLSVKPAILNFFGGIHGGAIAAFSERMAIACARTVVAEDKEIFLGE 107
            I+V ++  GR++  L V+P  LN  G +HGGAIA  ++      A + +         +
Sbjct: 3   GIRVVEVGPGRVVLRLPVRPRHLNPGGIVHGGAIATLADTAGGLAALSALPPGALAVTVD 62

Query: 108 LGISYLSAAP 117
           L ++YL  A 
Sbjct: 63  LNVNYLRPAR 72

Although orthologs of PaaI exist in archaea and eukaryotes, their function has not been determined. Sequence similarity between PaaI, E. coli medium chain acyl-CoA thioesterase II, and human thioesterase III suggests they all belong to the same thioesterase superfamily. The conserved fold present in these thioesterases is referred to as an asymmetric hot dog fold, similar to those of 4-hydroxybenzoyl-CoA thioesterase (4HBT) and the beta-hydroxydecanoyl-ACP dehydratases (FabA/FabZ). Length = 113
>gnl|CDD|239524 cd03440, hot_dog, The hotdog fold was initially identified in the E Back     alignment and domain information
>gnl|CDD|224961 COG2050, PaaI, HGG motif-containing thioesterase, possibly involved in aromatic compounds catabolism [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 130
PRK10254137 thioesterase; Provisional 99.89
PRK10293136 acyl-CoA esterase; Provisional 99.88
PLN02322154 acyl-CoA thioesterase 99.83
PRK11688154 hypothetical protein; Provisional 99.83
COG2050141 PaaI HGG motif-containing thioesterase, possibly i 99.82
TIGR00369117 unchar_dom_1 uncharacterized domain 1. Most protei 99.8
KOG3328148 consensus HGG motif-containing thioesterase [Gener 99.77
TIGR02286114 PaaD phenylacetic acid degradation protein PaaD. S 99.75
TIGR02447138 yiiD_Cterm thioesterase domain, putative. This fam 99.68
cd03443113 PaaI_thioesterase PaaI_thioesterase is a tetrameri 99.57
PF14539132 DUF4442: Domain of unknown function (DUF4442); PDB 99.48
PRK10694133 acyl-CoA esterase; Provisional 99.27
cd03442123 BFIT_BACH Brown fat-inducible thioesterase (BFIT). 99.18
COG1607157 Acyl-CoA hydrolase [Lipid metabolism] 99.03
PF0306179 4HBT: Thioesterase superfamily; InterPro: IPR00668 98.96
KOG4781237 consensus Uncharacterized conserved protein [Funct 98.88
PRK04424185 fatty acid biosynthesis transcriptional regulator; 98.77
cd0055699 Thioesterase_II Thioesterase II (TEII) is thought 98.7
PLN02647437 acyl-CoA thioesterase 98.64
cd00586110 4HBT 4-hydroxybenzoyl-CoA thioesterase (4HBT). Cat 98.29
PLN02647 437 acyl-CoA thioesterase 98.2
cd03440100 hot_dog The hotdog fold was initially identified i 98.17
PF09500144 YiiD_Cterm: Putative thioesterase (yiiD_Cterm); In 98.13
KOG2763357 consensus Acyl-CoA thioesterase [Lipid transport a 97.41
TIGR00051117 acyl-CoA thioester hydrolase, YbgC/YbaW family. Th 96.73
TIGR02799126 thio_ybgC tol-pal system-associated acyl-CoA thioe 96.72
PF13622 255 4HBT_3: Thioesterase-like superfamily; PDB: 2PIM_A 96.28
PRK10800130 acyl-CoA thioesterase YbgC; Provisional 96.17
cd03449128 R_hydratase (R)-hydratase [(R)-specific enoyl-CoA 95.58
cd0344594 Thioesterase_II_repeat2 Thioesterase II (TEII) is 95.43
COG0824137 FcbC Predicted thioesterase [General function pred 94.23
PRK07531495 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe 93.91
PF13279121 4HBT_2: Thioesterase-like superfamily; PDB: 2W3X_E 93.88
cd03441127 R_hydratase_like (R)-hydratase [(R)-specific enoyl 93.45
COG4109432 Predicted transcriptional regulator containing CBS 92.8
PRK00006147 fabZ (3R)-hydroxymyristoyl-ACP dehydratase; Review 91.65
PF01575122 MaoC_dehydratas: MaoC like domain; InterPro: IPR00 89.71
COG5496130 Predicted thioesterase [General function predictio 88.72
cd03455123 SAV4209 SAV4209 is a Streptomyces avermitilis prot 87.71
cd03447126 FAS_MaoC FAS_MaoC, the MaoC-like hot dog fold of t 87.26
cd03453127 SAV4209_like SAV4209_like. Similar in sequence to 86.76
cd01288131 FabZ FabZ is a 17kD beta-hydroxyacyl-acyl carrier 86.5
cd03446140 MaoC_like MoaC_like Similar to the MaoC (monoamine 82.7
>PRK10254 thioesterase; Provisional Back     alignment and domain information 
Probab=99.89  E-value=3.1e-22  Score=143.39  Aligned_cols=80  Identities=19%  Similarity=0.216  Sum_probs=76.1

Q ss_pred             CeEEEEEeCCeEEEEEEcCCCccCCCCCCcHHHHHHHHHHHHHHHHHhhccCCCceeEEEEEEEeecCCCCCeEEEEeee
Q 032902           48 HIKVHKIQRGRLICHLSVKPAILNFFGGIHGGAIAAFSERMAIACARTVVAEDKEIFLGELGISYLSAAPHNWKKCDCGC  127 (130)
Q Consensus        48 gi~i~~~~~g~v~~~l~v~~~~~N~~G~vHGG~iatl~D~a~g~a~~~~~~~~~~~~T~~l~i~fl~p~~~g~~~~~~~~  127 (130)
                      |+++.++++|+++++|+++++++|++|.+|||++++|+|+++++++....+.+..++|+|+++|||||++.|..+|++.+
T Consensus        25 Gi~i~ei~~g~~~~~l~v~~~~~n~~G~vHGGv~~tLaD~a~g~A~~~~~~~g~~~vTiel~in~Lrp~~~g~l~a~a~v  104 (137)
T PRK10254         25 GIVYTRLGDDVLEAEMPVDTRTHQPFGLLHGGASAALAETLGSMAGFLMTRDGQCVVGTELNATHHRPVSEGKVRGVCQP  104 (137)
T ss_pred             CcEEEEEeCCEEEEEEEcCccccCCCCcchHHHHHHHHHHHHHHHHHhhCCCCCeEEEEEEEeEEeccCcCCeEEEEEEE
Confidence            99999999999999999999999999999999999999999999998777778889999999999999999998898875

>PRK10293 acyl-CoA esterase; Provisional Back     alignment and domain information
>PLN02322 acyl-CoA thioesterase Back     alignment and domain information
>PRK11688 hypothetical protein; Provisional Back     alignment and domain information
>COG2050 PaaI HGG motif-containing thioesterase, possibly involved in aromatic compounds catabolism [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR00369 unchar_dom_1 uncharacterized domain 1 Back     alignment and domain information
>KOG3328 consensus HGG motif-containing thioesterase [General function prediction only] Back     alignment and domain information
>TIGR02286 PaaD phenylacetic acid degradation protein PaaD Back     alignment and domain information
>TIGR02447 yiiD_Cterm thioesterase domain, putative Back     alignment and domain information
>cd03443 PaaI_thioesterase PaaI_thioesterase is a tetrameric acyl-CoA thioesterase with a hot dog fold and one of several proteins responsible for phenylacetic acid (PA) degradation in bacteria Back     alignment and domain information
>PF14539 DUF4442: Domain of unknown function (DUF4442); PDB: 1YOC_B 1SH8_B Back     alignment and domain information
>PRK10694 acyl-CoA esterase; Provisional Back     alignment and domain information
>cd03442 BFIT_BACH Brown fat-inducible thioesterase (BFIT) Back     alignment and domain information
>COG1607 Acyl-CoA hydrolase [Lipid metabolism] Back     alignment and domain information
>PF03061 4HBT: Thioesterase superfamily; InterPro: IPR006683 This family contains a wide variety of enzymes, principally thioesterases Back     alignment and domain information
>KOG4781 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK04424 fatty acid biosynthesis transcriptional regulator; Provisional Back     alignment and domain information
>cd00556 Thioesterase_II Thioesterase II (TEII) is thought to regenerate misprimed nonribosomal peptide synthetases (NRPSs) as well as modular polyketide synthases (PKSs) by hydrolyzing acetyl groups bound to the peptidyl carrier protein (PCP) and acyl carrier protein (ACP) domains, respectively Back     alignment and domain information
>PLN02647 acyl-CoA thioesterase Back     alignment and domain information
>cd00586 4HBT 4-hydroxybenzoyl-CoA thioesterase (4HBT) Back     alignment and domain information
>PLN02647 acyl-CoA thioesterase Back     alignment and domain information
>cd03440 hot_dog The hotdog fold was initially identified in the E Back     alignment and domain information
>PF09500 YiiD_Cterm: Putative thioesterase (yiiD_Cterm); InterPro: IPR012660 This entry consists of a broadly distributed uncharacterised domain found often as a standalone protein Back     alignment and domain information
>KOG2763 consensus Acyl-CoA thioesterase [Lipid transport and metabolism] Back     alignment and domain information
>TIGR00051 acyl-CoA thioester hydrolase, YbgC/YbaW family Back     alignment and domain information
>TIGR02799 thio_ybgC tol-pal system-associated acyl-CoA thioesterase Back     alignment and domain information
>PF13622 4HBT_3: Thioesterase-like superfamily; PDB: 2PIM_A 3RQB_A 3CJY_A 3RD7_A 3BBJ_B Back     alignment and domain information
>PRK10800 acyl-CoA thioesterase YbgC; Provisional Back     alignment and domain information
>cd03449 R_hydratase (R)-hydratase [(R)-specific enoyl-CoA hydratase] catalyzes the hydration of trans-2-enoyl CoA to (R)-3-hydroxyacyl-CoA as part of the PHA (polyhydroxyalkanoate) biosynthetic pathway Back     alignment and domain information
>cd03445 Thioesterase_II_repeat2 Thioesterase II (TEII) is thought to regenerate misprimed nonribosomal peptide synthetases (NRPSs) as well as modular polyketide synthases (PKSs) by hydrolyzing acetyl groups bound to the peptidyl carrier protein (PCP) and acyl carrier protein (ACP) domains, respectively Back     alignment and domain information
>COG0824 FcbC Predicted thioesterase [General function prediction only] Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>PF13279 4HBT_2: Thioesterase-like superfamily; PDB: 2W3X_E 3CK1_A 2GF6_C 2NUJ_A 2HLJ_A 2XFL_B 2XEM_B 2OIW_B 2HX5_A 2FUJ_A Back     alignment and domain information
>cd03441 R_hydratase_like (R)-hydratase [(R)-specific enoyl-CoA hydratase] Back     alignment and domain information
>COG4109 Predicted transcriptional regulator containing CBS domains [Transcription] Back     alignment and domain information
>PRK00006 fabZ (3R)-hydroxymyristoyl-ACP dehydratase; Reviewed Back     alignment and domain information
>PF01575 MaoC_dehydratas: MaoC like domain; InterPro: IPR002539 The C terminus of the MaoC protein is found to share similarity with a wide variety of enzymes Back     alignment and domain information
>COG5496 Predicted thioesterase [General function prediction only] Back     alignment and domain information
>cd03455 SAV4209 SAV4209 is a Streptomyces avermitilis protein with a hot dog fold that is similar to those of (R)-specific enoyl-CoA hydratase, the peroxisomal Hydratase-Dehydrogenase-Epimerase (HDE) protein, and the fatty acid synthase beta subunit Back     alignment and domain information
>cd03447 FAS_MaoC FAS_MaoC, the MaoC-like hot dog fold of the fatty acid synthase, beta subunit Back     alignment and domain information
>cd03453 SAV4209_like SAV4209_like Back     alignment and domain information
>cd01288 FabZ FabZ is a 17kD beta-hydroxyacyl-acyl carrier protein (ACP) dehydratase that primarily catalyzes the dehydration of beta-hydroxyacyl-ACP to trans-2-acyl-ACP, the third step in the elongation phase of the bacterial/ plastid, type II, fatty-acid biosynthesis pathway Back     alignment and domain information
>cd03446 MaoC_like MoaC_like Similar to the MaoC (monoamine oxidase C) dehydratase regulatory protein but without the N-terminal PutA domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query130
3f5o_A148 Thioesterase superfamily member 2; hotdog fold, hy 3e-11
2h4u_A145 Thioesterase superfamily member 2; structural geno 1e-10
1o0i_A138 Hypothetical protein HI1161; structural genomics, 7e-09
1q4t_A151 Thioesterase; hot-DOG, hydrolase; HET: 4CO; 1.60A 2e-08
3nwz_A176 BH2602 protein; structural genomics, PSI-biology, 4e-08
2qwz_A159 Phenylacetic acid degradation-related protein; put 6e-08
1wlu_A136 PAAI protein, phenylacetic acid degradation protei 1e-07
3lbe_A163 Putative uncharacterized protein SMU.793; hypothet 1e-07
1zki_A133 Hypothetical protein PA5202; structural genomics, 1e-07
3e1e_A141 Thioesterase family protein; structural genomics, 2e-07
2fs2_A151 Phenylacetic acid degradation protein PAAI; operon 2e-07
3dkz_A142 Thioesterase superfamily protein; Q7W9W5, borpa, P 4e-07
3s4k_A144 Putative esterase RV1847/MT1895; seattle structura 7e-07
2ov9_A216 Hypothetical protein; rhodococcus SP. RHA1, RHA085 1e-06
4ae8_A211 Thioesterase superfamily member 4; hydrolase, hotd 2e-06
4ae7_A220 Thioesterase superfamily member 5; hydrolase, hotd 2e-06
2pim_A141 Phenylacetic acid degradation-related protein; thi 4e-06
3f1t_A148 Uncharacterized protein Q9I3C8_pseae; PAR319A, NES 8e-06
1sh8_A154 Hypothetical protein PA5026; structural genomics, 2e-05
3e29_A144 Uncharacterized protein Q7WE92_borbr; Q7WE92 NESG, 2e-05
3gek_A146 Putative thioesterase YHDA; structure genomics, NE 3e-05
2hbo_A158 Hypothetical protein (NP_422103.1); thioesterase/t 4e-05
1yoc_A147 Hypothetical protein PA1835; structural genomics, 1e-04
>3f5o_A Thioesterase superfamily member 2; hotdog fold, hydrolase; HET: UOC COA P6G; 1.70A {Homo sapiens} PDB: 2f0x_A* 2cy9_A Length = 148 Back     alignment and structure
 Score = 56.3 bits (136), Expect = 3e-11
 Identities = 18/80 (22%), Positives = 32/80 (40%), Gaps = 2/80 (2%)

Query: 38  NDSYSNILGRHIKVHKIQRGRLICHLSVKPAILNFFGGIHGGAIAAFSERMAIACARTVV 97
             ++  +LG  I +     G++IC + V+    N  G +HGG  A   +      A    
Sbjct: 18  ARNFERVLG-KITLVSAAPGKVICEMKVEEEHTNAIGTLHGGLTATLVD-NISTMALLCT 75

Query: 98  AEDKEIFLGELGISYLSAAP 117
                    ++ I+Y+S A 
Sbjct: 76  ERGAPGVSVDMNITYMSPAK 95
>2h4u_A Thioesterase superfamily member 2; structural genomics, structural genomics consortium, SGC, hydrolase; 2.20A {Homo sapiens} SCOP: d.38.1.5 Length = 145 Back     alignment and structure
>1o0i_A Hypothetical protein HI1161; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 1.70A {Haemophilus influenzae} SCOP: d.38.1.5 PDB: 1sc0_A 2b6e_A 3lz7_A Length = 138 Back     alignment and structure
>1q4t_A Thioesterase; hot-DOG, hydrolase; HET: 4CO; 1.60A {Arthrobacter SP} SCOP: d.38.1.5 PDB: 1q4s_A* 1q4u_A* 3r37_A* 3r36_B* 3r3d_A* 3r34_A* 3r35_A* 3r3f_A* 3r32_A* 3r3a_A* 3r3b_A* 3r3c_A* Length = 151 Back     alignment and structure
>3nwz_A BH2602 protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG, unknown FUN; HET: COA; 2.57A {Bacillus halodurans} Length = 176 Back     alignment and structure
>2qwz_A Phenylacetic acid degradation-related protein; putative thioesterase, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 2.15A {Silicibacter SP} Length = 159 Back     alignment and structure
>1wlu_A PAAI protein, phenylacetic acid degradation protein PAAI; thioesterase, hot DOG fold, S genomics; 1.45A {Thermus thermophilus HB8} SCOP: d.38.1.5 PDB: 1j1y_A 1wlv_A* 1wm6_A 1wn3_A* 2dsl_A Length = 136 Back     alignment and structure
>3lbe_A Putative uncharacterized protein SMU.793; hypothetical protein, unknown function; HET: COA; 1.70A {Streptococcus mutans} PDB: 3lbb_A* Length = 163 Back     alignment and structure
>1zki_A Hypothetical protein PA5202; structural genomics, PSI, protein ST initiative, midwest center for structural genomics, MCSG, U function; 1.70A {Pseudomonas aeruginosa} SCOP: d.38.1.5 Length = 133 Back     alignment and structure
>3e1e_A Thioesterase family protein; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Silicibacter pomeroyi} Length = 141 Back     alignment and structure
>2fs2_A Phenylacetic acid degradation protein PAAI; operon, structural genomics, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: d.38.1.5 PDB: 1psu_A Length = 151 Back     alignment and structure
>3dkz_A Thioesterase superfamily protein; Q7W9W5, borpa, PF03061, NESG, BPR208C, structural genomics, PSI-2, protein structure initiative; 2.40A {Bordetella parapertussis} Length = 142 Back     alignment and structure
>3s4k_A Putative esterase RV1847/MT1895; seattle structural genomics center for infectious disease, S hydrolase; 1.70A {Mycobacterium tuberculosis} Length = 144 Back     alignment and structure
>2ov9_A Hypothetical protein; rhodococcus SP. RHA1, RHA08564, structural genomics, PSI-2, structure initiative; HET: MSE; 1.90A {Rhodococcus SP} SCOP: d.38.1.5 Length = 216 Back     alignment and structure
>4ae8_A Thioesterase superfamily member 4; hydrolase, hotdog-fold; 1.59A {Homo sapiens} Length = 211 Back     alignment and structure
>4ae7_A Thioesterase superfamily member 5; hydrolase, hotdog-fold; 1.45A {Homo sapiens} Length = 220 Back     alignment and structure
>2pim_A Phenylacetic acid degradation-related protein; thioesterase superfamily, phenylacetic acid degradation-RELA protein; 2.20A {Ralstonia eutropha JMP134} Length = 141 Back     alignment and structure
>3f1t_A Uncharacterized protein Q9I3C8_pseae; PAR319A, NESG, structural genomics, PSI-2, Pro structure initiative; HET: MSE; 2.20A {Pseudomonas aeruginosa} Length = 148 Back     alignment and structure
>1sh8_A Hypothetical protein PA5026; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.50A {Pseudomonas aeruginosa} SCOP: d.38.1.5 Length = 154 Back     alignment and structure
>3e29_A Uncharacterized protein Q7WE92_borbr; Q7WE92 NESG, structural genomics, PSI-2, Pro structure initiative; 2.40A {Bordetella bronchiseptica} Length = 144 Back     alignment and structure
>3gek_A Putative thioesterase YHDA; structure genomics, NESG, KR113, Q9CHK5_lacla, lactococcus L YHDA, structural genomics, PSI-2; 2.24A {Lactococcus lactis subsp} Length = 146 Back     alignment and structure
>2hbo_A Hypothetical protein (NP_422103.1); thioesterase/thiol ester dehydrase-isomerase fold, structura genomics; HET: MSE PE4; 1.85A {Caulobacter vibrioides} SCOP: d.38.1.5 Length = 158 Back     alignment and structure
>1yoc_A Hypothetical protein PA1835; structural genomics, PSI, protein structure initiati midwest center for structural genomics, MCSG, sulfur SAD; 1.70A {Pseudomonas aeruginosa} SCOP: d.38.1.5 Length = 147 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query130
1sc0_A138 Hypothetical protein HI1161; structural genomics, 99.89
3e1e_A141 Thioesterase family protein; structural genomics, 99.86
3gek_A146 Putative thioesterase YHDA; structure genomics, NE 99.84
1yoc_A147 Hypothetical protein PA1835; structural genomics, 99.84
3f1t_A148 Uncharacterized protein Q9I3C8_pseae; PAR319A, NES 99.83
1o0i_A138 Hypothetical protein HI1161; structural genomics, 99.82
3e29_A144 Uncharacterized protein Q7WE92_borbr; Q7WE92 NESG, 99.81
3s4k_A144 Putative esterase RV1847/MT1895; seattle structura 99.81
3hdu_A157 Putative thioesterase; structural genomics, joint 99.81
3nwz_A176 BH2602 protein; structural genomics, PSI-biology, 99.81
1vh9_A149 P15, hypothetical protein YBDB; structural genomic 99.79
3f5o_A148 Thioesterase superfamily member 2; hotdog fold, hy 99.79
1vh5_A148 Hypothetical protein YDII; PSI, protein structure 99.79
3e8p_A164 Uncharacterized protein; X-RAY Q8E9M7 SOR246 NESG 99.78
3lbe_A163 Putative uncharacterized protein SMU.793; hypothet 99.78
2pim_A141 Phenylacetic acid degradation-related protein; thi 99.78
3dkz_A142 Thioesterase superfamily protein; Q7W9W5, borpa, P 99.77
4i82_A137 Putative uncharacterized protein; PAAI/YDII-like, 99.77
1t82_A155 Hypothetical acetyltransferase; structural genomic 99.77
2qwz_A159 Phenylacetic acid degradation-related protein; put 99.76
1q4t_A151 Thioesterase; hot-DOG, hydrolase; HET: 4CO; 1.60A 99.76
1sh8_A154 Hypothetical protein PA5026; structural genomics, 99.76
2fs2_A151 Phenylacetic acid degradation protein PAAI; operon 99.74
1zki_A133 Hypothetical protein PA5202; structural genomics, 99.7
4ae8_A211 Thioesterase superfamily member 4; hydrolase, hotd 99.69
3lw3_A145 HP0420 homologue; hotdog-fold, structural genomics 99.68
2hbo_A158 Hypothetical protein (NP_422103.1); thioesterase/t 99.67
2h4u_A145 Thioesterase superfamily member 2; structural geno 99.65
4ae7_A220 Thioesterase superfamily member 5; hydrolase, hotd 99.64
2ov9_A216 Hypothetical protein; rhodococcus SP. RHA1, RHA085 99.62
1wlu_A136 PAAI protein, phenylacetic acid degradation protei 99.62
1ixl_A131 Hypothetical protein PH1136; alpha+beta, hot-DOG-f 99.61
3lmb_A165 Uncharacterized protein; protein OLEI01261, unknow 99.56
3bnv_A152 CJ0977; virulence factor, hot-DOG fold, flagel unk 99.54
2prx_A160 Thioesterase superfamily protein; ZP_00837258.1, s 99.52
2f3x_A157 Transcription factor FAPR; 'HOT-DOG' fold / malony 99.48
2f41_A121 Transcription factor FAPR; 'HOT-DOG' fold, gene re 99.41
2qq2_A193 Cytosolic acyl coenzyme A thioester hydrolase; ACO 99.41
4ien_A163 Putative acyl-COA hydrolase; hot DOG fold; HET: CO 99.36
3d6l_A137 Putative hydrolase; hot DOG fold, thioesterase, ac 99.31
2q2b_A179 Cytosolic acyl coenzyme A thioester hydrolase; ACO 99.28
4a0z_A190 Transcription factor FAPR; lipid homeostasis; HET: 99.26
1y7u_A174 Acyl-COA hydrolase; structural genomics, coenzyme 99.24
3b7k_A 333 Acyl-coenzyme A thioesterase 12; hotdog fold, stru 99.24
1vpm_A169 Acyl-COA hydrolase; NP_241664.1, structural genomi 99.15
3bjk_A153 Acyl-COA thioester hydrolase HI0827; hotdog fold, 99.14
3b7k_A333 Acyl-coenzyme A thioesterase 12; hotdog fold, stru 99.11
2gvh_A288 AGR_L_2016P; 15159470, acyl-COA hydrolase, structu 99.11
2v1o_A151 Cytosolic acyl coenzyme A thioester hydrolase; acy 99.06
2gvh_A 288 AGR_L_2016P; 15159470, acyl-COA hydrolase, structu 99.06
2eis_A133 Hypothetical protein TTHB207; COA binding motif, N 99.02
2cwz_A141 Thioesterase family protein; structural genomics, 98.68
2q78_A153 Uncharacterized protein; structural genomics, join 98.61
1njk_A156 Hypothetical protein YBAW; structural genomics, th 98.58
2cye_A133 TTHA1846, putative thioesterase; structural genomi 98.56
3bbj_A 272 Putative thioesterase II; structural genomics, joi 98.46
2fuj_A137 Conserved hypothetical protein; structural genomic 98.29
1s5u_A138 Protein YBGC; structural genomics, hypothetical pr 98.24
2egj_A128 Hypothetical protein AQ_1494; structural genomics; 98.19
3kuv_A139 Fluoroacetyl coenzyme A thioesterase; fluoroacetyl 98.18
2oiw_A136 Putative 4-hydroxybenzoyl-COA thioesterase; struct 98.15
3ck1_A150 Putative thioesterase; structural genomics, joint 98.04
1z54_A132 Probable thioesterase; hypothetical protein, struc 98.01
2hlj_A157 Hypothetical protein; putative thioesterase, struc 97.98
2gf6_A135 Conserved hypothetical protein; putative thioester 97.95
1lo7_A141 4-hydroxybenzoyl-COA thioesterase; hot DOG fold, c 97.9
2ali_A158 Hypothetical protein PA2801; structural genomics, 97.87
2xem_A150 DYNE7, TEBC; biosynthetic protein, polyketide bios 97.86
2o5u_A148 Thioesterase; putative thioesterese,, hydrolase; 1 97.83
2pzh_A135 Hypothetical protein HP_0496; lipid, acyl-COA, bac 97.82
2w3x_A147 CALE7; hydrolase, hotdog fold, thioesterase, enedi 97.77
2nuj_A163 Thioesterase superfamily; YP_509914.1, structural 97.73
2hx5_A152 Hypothetical protein; thioesterase/thiol ester deh 97.71
2oaf_A151 Thioesterase superfamily; YP_508616.1, structural 97.7
3qoo_A138 Uncharacterized protein; structural genomics, PSI- 97.36
4i4j_A159 ACP-polyene thioesterase; structural genomics, PSI 97.24
3cjy_A 259 Putative thioesterase; YP_496845.1, structural gen 97.11
3r87_A135 Putative uncharacterized protein; unknown function 97.02
1iq6_A134 (R)-hydratase, (R)-specific enoyl-COA hydratase; p 96.8
3hm0_A167 Probable thioesterase; niaid, ssgcid, decode, UW, 96.65
3rqb_A 275 Uncharacterized protein; structural genomics, PSI- 96.31
1q6w_A161 Monoamine oxidase regulatory protein, putative; st 95.8
2own_A 262 Putative oleoyl-[acyl-carrier protein] thioestera; 94.32
2b3n_A159 Hypothetical protein AF1124; structural genomics, 94.09
2ess_A 248 Acyl-ACP thioesterase; NP_810988.1, structural gen 93.17
1tbu_A118 Peroxisomal acyl-coenzyme A thioester hydrolase 1; 92.4
3exz_A154 MAOC-like dehydratase; Q2RSA1_rhort, NESG, RRR103A 92.15
1u1z_A168 (3R)-hydroxymyristoyl-[acyl carrier protein] dehyd 91.3
2own_A262 Putative oleoyl-[acyl-carrier protein] thioestera; 91.23
3ir3_A148 HTD2, 3-hydroxyacyl-thioester dehydratase 2; struc 90.87
1c8u_A 285 Acyl-COA thioesterase II; internal repeats, hydrol 90.27
2c2i_A151 RV0130; hotdog, hydratase, lyase, structural prote 88.99
1z6b_A154 Pffabz, fatty acid synthesis protein; malaria, bet 88.14
3d6x_A146 (3R)-hydroxymyristoyl-[acyl-carrier-protein] DEHY; 85.78
4gak_A 250 Acyl-ACP thioesterase; MCSG, PSI-biology, structur 84.21
4ffu_A176 Oxidase; structural genomics, protein structure in 82.61
3k67_A159 Putative dehydratase AF1124; hypothetical protein 82.33
3u0a_A 285 Acyl-COA thioesterase II TESB2; structural genomic 82.03
>1sc0_A Hypothetical protein HI1161; structural genomics, unknown function, PSI-2, protein structure initiative; 1.70A {Haemophilus influenzae} SCOP: d.38.1.5 PDB: 2b6e_A 3lz7_A Back     alignment and structure
Probab=99.89  E-value=3.4e-22  Score=141.65  Aligned_cols=82  Identities=15%  Similarity=0.192  Sum_probs=77.5

Q ss_pred             CCeEEEEEeCCeEEEEEEcCCCccCCCCCCcHHHHHHHHHHHHHHHHHhhccCCCceeEEEEEEEeecCCCCCeEEEEee
Q 032902           47 RHIKVHKIQRGRLICHLSVKPAILNFFGGIHGGAIAAFSERMAIACARTVVAEDKEIFLGELGISYLSAAPHNWKKCDCG  126 (130)
Q Consensus        47 ~gi~i~~~~~g~v~~~l~v~~~~~N~~G~vHGG~iatl~D~a~g~a~~~~~~~~~~~~T~~l~i~fl~p~~~g~~~~~~~  126 (130)
                      +|+++.++++|+++++|+++++|+|++|.+|||++++|+|+++++++....+.+..++|+|++++|+||++.|+.+++++
T Consensus        24 LGi~~~~~~~g~~~~~~~v~~~~~n~~G~~HGG~~~~l~D~a~~~a~~~~~~~~~~~vt~~l~i~flrpa~~g~l~a~a~  103 (138)
T 1sc0_A           24 LGIEISAFGEDWIEATMPVDHRTMQPFGVLHGGVSVALAETIGSLAGSLCLEEGKTVVGLDINANHLRPVRSGKVTARAT  103 (138)
T ss_dssp             TTCEEEEECSSCEEEEEECSTTTBCTTSSBCHHHHHHHHHHHHHHHHHHTSCTTCEEEEEEEEEEECSCCCSSEEEEEEE
T ss_pred             cCCEEEEEeCCEEEEEEEcCHHHcCCCCcCcHHHHHHHHHHHHHHHHHHhCCCCceeeeeEEEEEEEccCCCCcEEEEEE
Confidence            49999999999999999999999999999999999999999999999988777888899999999999999999999887


Q ss_pred             ee
Q 032902          127 CS  128 (130)
Q Consensus       127 ~~  128 (130)
                      +-
T Consensus       104 v~  105 (138)
T 1sc0_A          104 PI  105 (138)
T ss_dssp             EE
T ss_pred             EE
Confidence            63
>3e1e_A Thioesterase family protein; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Silicibacter pomeroyi} Back     alignment and structure
>3gek_A Putative thioesterase YHDA; structure genomics, NESG, KR113, Q9CHK5_lacla, lactococcus L YHDA, structural genomics, PSI-2; 2.24A {Lactococcus lactis subsp} Back     alignment and structure
>1yoc_A Hypothetical protein PA1835; structural genomics, PSI, protein structure initiati midwest center for structural genomics, MCSG, sulfur SAD; 1.70A {Pseudomonas aeruginosa} SCOP: d.38.1.5 Back     alignment and structure
>3f1t_A Uncharacterized protein Q9I3C8_pseae; PAR319A, NESG, structural genomics, PSI-2, Pro structure initiative; HET: MSE; 2.20A {Pseudomonas aeruginosa} Back     alignment and structure
>1o0i_A Hypothetical protein HI1161; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 1.70A {Haemophilus influenzae} PDB: 1sc0_A 2b6e_A 3lz7_A Back     alignment and structure
>3e29_A Uncharacterized protein Q7WE92_borbr; Q7WE92 NESG, structural genomics, PSI-2, Pro structure initiative; 2.40A {Bordetella bronchiseptica} SCOP: d.38.1.0 Back     alignment and structure
>3s4k_A Putative esterase RV1847/MT1895; seattle structural genomics center for infectious disease, S hydrolase; 1.70A {Mycobacterium tuberculosis} SCOP: d.38.1.0 Back     alignment and structure
>3hdu_A Putative thioesterase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 2.50A {Syntrophus aciditrophicus SB} Back     alignment and structure
>3nwz_A BH2602 protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG, unknown FUN; HET: COA; 2.57A {Bacillus halodurans} Back     alignment and structure
>1vh9_A P15, hypothetical protein YBDB; structural genomics, unknown function; 2.15A {Escherichia coli} SCOP: d.38.1.5 Back     alignment and structure
>3f5o_A Thioesterase superfamily member 2; hotdog fold, hydrolase; HET: UOC COA P6G; 1.70A {Homo sapiens} SCOP: d.38.1.5 PDB: 2f0x_A* 2cy9_A Back     alignment and structure
>1vh5_A Hypothetical protein YDII; PSI, protein structure initiative, NEW YORK SGX research center for structural genomics, nysgxrc; 1.34A {Escherichia coli} SCOP: d.38.1.5 PDB: 1vi8_A 1sbk_A Back     alignment and structure
>3e8p_A Uncharacterized protein; X-RAY Q8E9M7 SOR246 NESG structure, structural genomics, PSI-2, protein structure initiative; 2.30A {Shewanella oneidensis} Back     alignment and structure
>3lbe_A Putative uncharacterized protein SMU.793; hypothetical protein, unknown function; HET: COA; 1.70A {Streptococcus mutans} PDB: 3lbb_A* Back     alignment and structure
>2pim_A Phenylacetic acid degradation-related protein; thioesterase superfamily, phenylacetic acid degradation-RELA protein; 2.20A {Ralstonia eutropha JMP134} Back     alignment and structure
>3dkz_A Thioesterase superfamily protein; Q7W9W5, borpa, PF03061, NESG, BPR208C, structural genomics, PSI-2, protein structure initiative; 2.40A {Bordetella parapertussis} Back     alignment and structure
>4i82_A Putative uncharacterized protein; PAAI/YDII-like, hot DOG fold, thioesterase, hydrolase; 2.50A {Streptococcus pneumoniae} Back     alignment and structure
>1t82_A Hypothetical acetyltransferase; structural genomics, alpha-beta dimeric protein with A fold resembling A hotdog, PSI; 1.70A {Shewanella oneidensis} SCOP: d.38.1.5 Back     alignment and structure
>2qwz_A Phenylacetic acid degradation-related protein; putative thioesterase, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 2.15A {Silicibacter SP} Back     alignment and structure
>1q4t_A Thioesterase; hot-DOG, hydrolase; HET: 4CO; 1.60A {Arthrobacter SP} SCOP: d.38.1.5 PDB: 1q4s_A* 1q4u_A* 3r37_A* 3r36_B* 3r3d_A* 3r34_A* 3r35_A* 3r3f_A* 3r32_A* 3r3a_A* 3r3b_A* 3r3c_A* Back     alignment and structure
>1sh8_A Hypothetical protein PA5026; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.50A {Pseudomonas aeruginosa} SCOP: d.38.1.5 Back     alignment and structure
>2fs2_A Phenylacetic acid degradation protein PAAI; operon, structural genomics, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: d.38.1.5 PDB: 1psu_A Back     alignment and structure
>1zki_A Hypothetical protein PA5202; structural genomics, PSI, protein ST initiative, midwest center for structural genomics, MCSG, U function; 1.70A {Pseudomonas aeruginosa} SCOP: d.38.1.5 Back     alignment and structure
>4ae8_A Thioesterase superfamily member 4; hydrolase, hotdog-fold; 1.59A {Homo sapiens} PDB: 4gah_A* Back     alignment and structure
>3lw3_A HP0420 homologue; hotdog-fold, structural genomics, unknown function; 1.60A {Helicobacter felis} PDB: 3lwg_A Back     alignment and structure
>2hbo_A Hypothetical protein (NP_422103.1); thioesterase/thiol ester dehydrase-isomerase fold, structura genomics; HET: MSE PE4; 1.85A {Caulobacter vibrioides} SCOP: d.38.1.5 Back     alignment and structure
>2h4u_A Thioesterase superfamily member 2; structural genomics, structural genomics consortium, SGC, hydrolase; 2.20A {Homo sapiens} SCOP: d.38.1.5 Back     alignment and structure
>4ae7_A Thioesterase superfamily member 5; hydrolase, hotdog-fold; 1.45A {Homo sapiens} Back     alignment and structure
>2ov9_A Hypothetical protein; rhodococcus SP. RHA1, RHA08564, structural genomics, PSI-2, structure initiative; HET: MSE; 1.90A {Rhodococcus SP} SCOP: d.38.1.5 Back     alignment and structure
>1wlu_A PAAI protein, phenylacetic acid degradation protein PAAI; thioesterase, hot DOG fold, S genomics; 1.45A {Thermus thermophilus HB8} SCOP: d.38.1.5 PDB: 1j1y_A 1wlv_A* 1wm6_A 1wn3_A* 2dsl_A Back     alignment and structure
>1ixl_A Hypothetical protein PH1136; alpha+beta, hot-DOG-fold, structural genomics, unknown funct; 1.94A {Pyrococcus horikoshii} SCOP: d.38.1.5 Back     alignment and structure
>3lmb_A Uncharacterized protein; protein OLEI01261, unknown function, chlorobaculum tepidum T structural genomics, PSI2, MCSG; HET: MSE; 2.10A {Oleispira antarctica rb-8} SCOP: d.38.1.0 Back     alignment and structure
>3bnv_A CJ0977; virulence factor, hot-DOG fold, flagel unknown function; HET: MSE; 2.60A {Campylobacter jejuni} Back     alignment and structure
>2prx_A Thioesterase superfamily protein; ZP_00837258.1, structural joint center for structural genomics, JCSG, protein structu initiative, PSI-2; 1.50A {Shewanella loihica} Back     alignment and structure
>2f3x_A Transcription factor FAPR; 'HOT-DOG' fold / malonyl-COA complex, gene regulation; HET: MLC; 3.10A {Bacillus subtilis} SCOP: d.38.1.5 Back     alignment and structure
>2f41_A Transcription factor FAPR; 'HOT-DOG' fold, gene regulation; 2.50A {Bacillus subtilis} SCOP: d.38.1.5 Back     alignment and structure
>2qq2_A Cytosolic acyl coenzyme A thioester hydrolase; ACOT7, C-terminal domain, thioesterase, structural genomics, structural genomics consortium, SGC; 2.80A {Homo sapiens} Back     alignment and structure
>4ien_A Putative acyl-COA hydrolase; hot DOG fold; HET: COA GDP; 2.00A {Neisseria meningitidis} Back     alignment and structure
>3d6l_A Putative hydrolase; hot DOG fold, thioesterase, acyl-COA; 2.59A {Campylobacter jejuni} Back     alignment and structure
>2q2b_A Cytosolic acyl coenzyme A thioester hydrolase; ACOT7, C-terminal domain; 2.50A {Mus musculus} Back     alignment and structure
>4a0z_A Transcription factor FAPR; lipid homeostasis; HET: MLC; 1.90A {Staphylococcus aureus} PDB: 4a0y_A 4a0x_A* 4a12_A Back     alignment and structure
>1y7u_A Acyl-COA hydrolase; structural genomics, coenzyme A, protein structure initiative, PSI, midwest center for structural GE MCSG; HET: COA; 2.80A {Bacillus cereus} SCOP: d.38.1.1 Back     alignment and structure
>3b7k_A Acyl-coenzyme A thioesterase 12; hotdog fold, structural genomics, structural genomics consor SGC, fatty acid metabolism, hydrolase; HET: COA; 2.70A {Homo sapiens} Back     alignment and structure
>1vpm_A Acyl-COA hydrolase; NP_241664.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative hydrolase; HET: COA; 1.66A {Bacillus halodurans} SCOP: d.38.1.1 PDB: 3sps_A Back     alignment and structure
>3bjk_A Acyl-COA thioester hydrolase HI0827; hotdog fold, trimer of dimers, YCIA, structural GENO structure 2 function project, S2F; HET: CIT; 1.90A {Haemophilus influenzae rd KW20} PDB: 1yli_A* Back     alignment and structure
>3b7k_A Acyl-coenzyme A thioesterase 12; hotdog fold, structural genomics, structural genomics consor SGC, fatty acid metabolism, hydrolase; HET: COA; 2.70A {Homo sapiens} Back     alignment and structure
>2gvh_A AGR_L_2016P; 15159470, acyl-COA hydrolase, structural genomics, joint CEN structural genomics, JCSG, protein structure initiative; 2.50A {Agrobacterium tumefaciens} SCOP: d.38.1.1 d.38.1.1 Back     alignment and structure
>2v1o_A Cytosolic acyl coenzyme A thioester hydrolase; acyl-COA thioesterase 7, serine esterase, protein structure, domain duplication, ACOT7, macrophage; HET: COA; 1.78A {Mus musculus} Back     alignment and structure
>2gvh_A AGR_L_2016P; 15159470, acyl-COA hydrolase, structural genomics, joint CEN structural genomics, JCSG, protein structure initiative; 2.50A {Agrobacterium tumefaciens} SCOP: d.38.1.1 d.38.1.1 Back     alignment and structure
>2eis_A Hypothetical protein TTHB207; COA binding motif, NPPSFA, national project on protein struc functional analyses; HET: COA; 2.10A {Thermus thermophilus} Back     alignment and structure
>2cwz_A Thioesterase family protein; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.85A {Thermus thermophilus} SCOP: d.38.1.7 Back     alignment and structure
>2q78_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE MLC; 2.20A {Thermotoga maritima MSB8} SCOP: d.38.1.7 Back     alignment and structure
>1njk_A Hypothetical protein YBAW; structural genomics, thioesterase, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.90A {Escherichia coli} SCOP: d.38.1.1 Back     alignment and structure
>2cye_A TTHA1846, putative thioesterase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: COA; 1.90A {Thermus thermophilus} SCOP: d.38.1.1 Back     alignment and structure
>3bbj_A Putative thioesterase II; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; 2.16A {Thermobifida fusca} Back     alignment and structure
>2fuj_A Conserved hypothetical protein; structural genomics, conserved hypot protein, hot DOG domain, acyl-COA thioesterase, hydrolase; 1.70A {Xanthomonas campestris PV} SCOP: d.38.1.1 Back     alignment and structure
>1s5u_A Protein YBGC; structural genomics, hypothetical protein, thioesterase fold, PSI, protein structure initiative; 1.70A {Escherichia coli} SCOP: d.38.1.1 Back     alignment and structure
>2egj_A Hypothetical protein AQ_1494; structural genomics; 1.80A {Aquifex aeolicus} PDB: 2egi_A 2egr_A Back     alignment and structure
>3kuv_A Fluoroacetyl coenzyme A thioesterase; fluoroacetyl-COA thioesterase FLK, hot DOG folding, thioeste hydrolase; 1.50A {Streptomyces cattleya} PDB: 3kuw_A 3kvu_A* 3p2q_A 3p2r_A 3p2s_A 3kv7_A 3kv8_A 3kvz_A* 3kw1_A* 3kx7_A 3kx8_A 3kvi_A 3p3i_A 3p3f_A Back     alignment and structure
>2oiw_A Putative 4-hydroxybenzoyl-COA thioesterase; structural genomics, protein structure initiative, midwest center for structu genomics; 2.00A {Geobacillus stearothermophilus} SCOP: d.38.1.1 Back     alignment and structure
>3ck1_A Putative thioesterase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.74A {Ralstonia eutropha} Back     alignment and structure
>1z54_A Probable thioesterase; hypothetical protein, structural genom NPPSFA, riken structural genomics/proteomics initiative; 2.10A {Thermus thermophilus} SCOP: d.38.1.1 Back     alignment and structure
>2hlj_A Hypothetical protein; putative thioesterase, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; HET: MSE; 2.00A {Pseudomonas putida} SCOP: d.38.1.1 Back     alignment and structure
>2gf6_A Conserved hypothetical protein; putative thioesterase, structural genomics, joint center for structural genomics, JCSG; HET: COA; 1.91A {Sulfolobus solfataricus} SCOP: d.38.1.1 Back     alignment and structure
>1lo7_A 4-hydroxybenzoyl-COA thioesterase; hot DOG fold, catalytic mechanism, hydrolase; HET: 4CO; 1.50A {Pseudomonas SP} SCOP: d.38.1.1 PDB: 1bvq_A* 1lo8_A* 1lo9_A* Back     alignment and structure
>2ali_A Hypothetical protein PA2801; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.75A {Pseudomonas aeruginosa} SCOP: d.38.1.1 PDB: 3qy3_A Back     alignment and structure
>2xem_A DYNE7, TEBC; biosynthetic protein, polyketide biosynthesis, enediyne anti agent, thioesterase; HET: SSV; 2.10A {Micromonospora chersina} PDB: 2xfl_A Back     alignment and structure
>2o5u_A Thioesterase; putative thioesterese,, hydrolase; 1.91A {Pseudomonas aeruginosa} SCOP: d.38.1.1 PDB: 2av9_A 2o6t_A 2o6b_A 2o6u_A Back     alignment and structure
>2pzh_A Hypothetical protein HP_0496; lipid, acyl-COA, bacterial membrane, TOL-PAL system, thioest hot-DOG fold, hydrolase; 1.70A {Helicobacter pylori} Back     alignment and structure
>2w3x_A CALE7; hydrolase, hotdog fold, thioesterase, enediyne biosynthesis; HET: JEF; 1.75A {Micromonospora echinospora} Back     alignment and structure
>2nuj_A Thioesterase superfamily; YP_509914.1, structural genomics, protein structure initiative, joint center for structural G JCSG, hydrolase; 2.00A {Jannaschia} SCOP: d.38.1.1 Back     alignment and structure
>2hx5_A Hypothetical protein; thioesterase/thiol ester dehydrase-isomerase fold, structura genomics, joint center for structural genomics, JCSG; 1.50A {Prochlorococcus marinus} SCOP: d.38.1.1 Back     alignment and structure
>2oaf_A Thioesterase superfamily; YP_508616.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2, hydrolase; HET: CIT PGE; 2.00A {Jannaschia SP} SCOP: d.38.1.1 Back     alignment and structure
>3qoo_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, hot-DOG superfamily; 1.25A {Thermanaerovibrio acidaminovorans} Back     alignment and structure
>4i4j_A ACP-polyene thioesterase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: TAR; 2.78A {Streptomyces globisporus} Back     alignment and structure
>3cjy_A Putative thioesterase; YP_496845.1, structural genomics, JOI for structural genomics, JCSG; HET: MSE PGE; 1.70A {Novosphingobium aromaticivorans} Back     alignment and structure
>3r87_A Putative uncharacterized protein; unknown function; 1.05A {Photobacterium profundum} Back     alignment and structure
>1iq6_A (R)-hydratase, (R)-specific enoyl-COA hydratase; polyhydroxyalkanoate, aeromonas caviae, the hydratase 2 motif, lyase; 1.50A {Aeromonas punctata} SCOP: d.38.1.4 Back     alignment and structure
>3hm0_A Probable thioesterase; niaid, ssgcid, decode, UW, SBRI, infectious disease, rhizobiales, bacteremia, endocarditis, bacillary angiomatosis; 2.50A {Bartonella henselae} Back     alignment and structure
>3rqb_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta sandwich; HET: MSE; 2.80A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>1q6w_A Monoamine oxidase regulatory protein, putative; structural genomics, nysgxrc T805, hot DOG fold; 2.81A {Archaeoglobus fulgidus} SCOP: d.38.1.4 Back     alignment and structure
>2own_A Putative oleoyl-[acyl-carrier protein] thioestera; NP_784467.1, oleoyl thioesterase (putative); 2.00A {Lactobacillus plantarum} SCOP: d.38.1.8 d.38.1.8 Back     alignment and structure
>2b3n_A Hypothetical protein AF1124; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.25A {Archaeoglobus fulgidus} PDB: 2b3m_A 3k67_A Back     alignment and structure
>2ess_A Acyl-ACP thioesterase; NP_810988.1, structural genomics, JOI for structural genomics, JCSG, protein structure initiative hydrolase; HET: MSE; 1.90A {Bacteroides thetaiotaomicron} SCOP: d.38.1.8 d.38.1.8 Back     alignment and structure
>1tbu_A Peroxisomal acyl-coenzyme A thioester hydrolase 1; yeast peroxisomal thioesterase, , domain swapping, iodine SOAK, siras; 2.20A {Saccharomyces cerevisiae} SCOP: d.38.1.3 Back     alignment and structure
>3exz_A MAOC-like dehydratase; Q2RSA1_rhort, NESG, RRR103A, structur genomics, PSI-2, protein structure initiative; 2.30A {Rhodospirillum rubrum} Back     alignment and structure
>1u1z_A (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase; fatty acid biosynthesis, hot DOG fold, lyase; 2.50A {Pseudomonas aeruginosa} SCOP: d.38.1.6 Back     alignment and structure
>2own_A Putative oleoyl-[acyl-carrier protein] thioestera; NP_784467.1, oleoyl thioesterase (putative); 2.00A {Lactobacillus plantarum} SCOP: d.38.1.8 d.38.1.8 Back     alignment and structure
>3ir3_A HTD2, 3-hydroxyacyl-thioester dehydratase 2; structural GENO structural genomics consortium, SGC, lyase; 1.99A {Homo sapiens} Back     alignment and structure
>1c8u_A Acyl-COA thioesterase II; internal repeats, hydrolase; HET: LDA; 1.90A {Escherichia coli} SCOP: d.38.1.3 d.38.1.3 Back     alignment and structure
>2c2i_A RV0130; hotdog, hydratase, lyase, structural proteomics in europe, spine, structural genomics; 1.8A {Mycobacterium tuberculosis} SCOP: d.38.1.4 Back     alignment and structure
>1z6b_A Pffabz, fatty acid synthesis protein; malaria, beta-hydroxyacyl-ACP dehydra fatty acid biosynthesis, SAD phasing, lyase; 2.09A {Plasmodium falciparum} SCOP: d.38.1.6 PDB: 3az8_A* 3az9_A* 3aza_A* 3azb_A* 1zhg_A 2oki_A 2okh_A Back     alignment and structure
>3d6x_A (3R)-hydroxymyristoyl-[acyl-carrier-protein] DEHY; FABZ, hot DOG fold, dehydratase, lipid biosynthesis, lipid synthesis, lyase; HET: MSE; 2.59A {Campylobacter jejuni subsp} Back     alignment and structure
>4gak_A Acyl-ACP thioesterase; MCSG, PSI-biology, structural genomics, midwest center for S genomics, hydrolase; HET: MSE; 1.90A {Spirosoma linguale} Back     alignment and structure
>4ffu_A Oxidase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgrc, PS biology; HET: MSE; 1.80A {Sinorhizobium meliloti} Back     alignment and structure
>3k67_A Putative dehydratase AF1124; hypothetical protein AF1124, structural genomics, PSI, protein structure initiative; 1.25A {Archaeoglobus fulgidus} PDB: 2b3m_A Back     alignment and structure
>3u0a_A Acyl-COA thioesterase II TESB2; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, hydrolase; 2.50A {Mycobacterium marinum} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 130
d2ov9a1203 d.38.1.5 (A:7-209) Hypothetical protein RHA1_ro058 4e-05
d1vpma_155 d.38.1.1 (A:) Acyl-CoA hydrolase BH0798 {Bacillus 8e-04
d1sh8a_153 d.38.1.5 (A:) Hypothetical protein PA5026 {Pseudom 0.001
>d2ov9a1 d.38.1.5 (A:7-209) Hypothetical protein RHA1_ro05818 {Rhodococcus sp. RHA1 [TaxId: 101510]} Length = 203 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Thioesterase/thiol ester dehydrase-isomerase
superfamily: Thioesterase/thiol ester dehydrase-isomerase
family: PaaI/YdiI-like
domain: Hypothetical protein RHA1 ro05818
species: Rhodococcus sp. RHA1 [TaxId: 101510]

 Score = 39.2 bits (91), Expect = 4e-05
 Identities = 12/80 (15%), Positives = 22/80 (27%), Gaps = 3/80 (3%)

Query: 42  SNILGRHIKVHKIQRGRLICHLSVKPAILNFFGGIHGGAIAAFSERMAIACARTVVAEDK 101
            N L   + +  +  G +   +++        G +HGG  A     +            K
Sbjct: 89  ENALAPPVVLEGLSDGSVRGTVTLTIPYQGPPGHVHGGVSALL---LDHVLGVANAWGGK 145

Query: 102 EIFLGELGISYLSAAPHNWK 121
                +L   Y    P    
Sbjct: 146 AGMTAQLSTRYHRPTPLFEP 165
>d1vpma_ d.38.1.1 (A:) Acyl-CoA hydrolase BH0798 {Bacillus halodurans [TaxId: 86665]} Length = 155 Back     information, alignment and structure
>d1sh8a_ d.38.1.5 (A:) Hypothetical protein PA5026 {Pseudomonas aeruginosa [TaxId: 287]} Length = 153 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query130
d1vh9a_138 Hypothetical protein YbdB {Escherichia coli [TaxId 99.87
d1zkia1126 Hypothetical protein PA5202 {Pseudomonas aeruginos 99.86
d1sc0a_137 Hypothetical protein HI1161 {Haemophilus influenza 99.86
d2f0xa1136 Hypothetical protein Them2 {Human (Homo sapiens) [ 99.85
d1vh5a_138 Hypothetical protein YdiI {Escherichia coli [TaxId 99.85
d1q4ua_140 4-hydroxybenzoyl CoA thioesterase {Arthrobacter sp 99.84
d2fs2a1131 Phenylacetic acid degradation protein PaaI {Escher 99.83
d1yoca1145 Hypothetical protein PA1835 {Pseudomonas aeruginos 99.82
d1wlua1116 Phenylacetic acid degradation protein PaaI {Thermu 99.81
d1ixla_130 Hypothetical protein PH1136 {Archaeon Pyrococcus h 99.78
d2hboa1142 Hypothetical protein CC3309 {Caulobacter crescentu 99.75
d1t82a_143 Putative thioesterase SO4397 {Shewanella oneidensi 99.72
d1sh8a_153 Hypothetical protein PA5026 {Pseudomonas aeruginos 99.72
d2f41a1111 Transcription factor FapR, C-terminal domain {Baci 99.57
d2ov9a1203 Hypothetical protein RHA1_ro05818 {Rhodococcus sp. 99.57
d1ylia1142 Putative acyl-coa thioester hydrolase HI0827 {Haem 99.39
d2gvha2116 Probable acyl-CoA hydrolase AGR_L_2016 {Agrobacter 99.31
d1y7ua1164 Acyl-coa hydrolase BC2038 {Bacillus cereus [TaxId: 99.28
d2gvha1135 Probable acyl-CoA hydrolase AGR_L_2016 {Agrobacter 99.16
d1vpma_155 Acyl-CoA hydrolase BH0798 {Bacillus halodurans [Ta 99.09
d1lo7a_140 4-hydroxybenzoyl-CoA thioesterase {Pseudomonas sp. 97.06
d2cwza1138 Hypothetical protein TTHA0967 {Thermus thermophilu 96.93
d2fuja1118 Hypothetical protein XCC1147 {Xanthomonas campestr 96.88
d1s5ua_129 Hypothetical protein YbgC {Escherichia coli [TaxId 96.78
d2hx5a1144 Hypothetical protein PMT2055 {Prochlorococcus mari 96.69
d2q78a1130 Uncharacterized protein TM0581 {Thermotoga maritim 96.56
d1njka_133 Hypothetical protein YbaW {Escherichia coli [TaxId 96.47
d1z54a1132 Probable thioesterase TTHA0908 {Thermus thermophil 96.39
d2cyea1132 Probable thioesterase TTHA1846 {Thermus thermophil 96.29
d2hlja1156 Hypothetical protein PP0301 {Pseudomonas putida [T 96.12
d2alia1130 Hypothetical protein PA2801 {Pseudomonas aeruginos 96.12
d2oafa1143 Hypothetical protein Jann0674 {Jannaschia sp. ccs1 96.06
d2oiwa1131 GK1870 orthologue {Bacillus stearothermophilus [Ta 95.94
d2nuja1159 Hypothetical protein Jann_1972 {Jannaschia sp. CCS 95.54
d2essa1149 Acyl-ACP thioesterase {Bacteroides thetaiotaomicro 95.36
d2o5ua1139 Hypothetical thioesterase PA5185 {Pseudomonas aeru 95.1
d2gf6a1134 Hypothetical protein SSO2295 {Archaeon Sulfolobus 94.75
d2owna1147 Putative oleoyl-ACP thioesterase LP0708 {Lactobaci 94.52
d2owna2109 Putative oleoyl-ACP thioesterase LP0708 {Lactobaci 91.85
d2bi0a2152 Hypothetical protein Rv0216/MT0226 {Mycobacterium 88.34
d2c2ia1149 Hypothetical protein Rv0130 {Mycobacterium tubercu 84.42
d1iq6a_132 (R)-specific enoyl-CoA hydratase {Aeromonas caviae 83.96
d1s9ca1126 2-enoyl-coa hydratase domain of multifunctional pe 83.82
d2essa298 Acyl-ACP thioesterase {Bacteroides thetaiotaomicro 82.71
d1tbua1104 Peroxisomal long-chain acyl-CoA thioesterase 1, TE 81.78
d2bi0a1178 Hypothetical protein Rv0216/MT0226 {Mycobacterium 80.65
>d1vh9a_ d.38.1.5 (A:) Hypothetical protein YbdB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Thioesterase/thiol ester dehydrase-isomerase
superfamily: Thioesterase/thiol ester dehydrase-isomerase
family: PaaI/YdiI-like
domain: Hypothetical protein YbdB
species: Escherichia coli [TaxId: 562]

Probab=99.87  E-value=1.1e-21  Score=137.33  Aligned_cols=82  Identities=18%  Similarity=0.196  Sum_probs=76.8

Q ss_pred             CCeEEEEEeCCeEEEEEEcCCCccCCCCCCcHHHHHHHHHHHHHHHHHhhccCCCceeEEEEEEEeecCCCCCeEEEEee
Q 032902           47 RHIKVHKIQRGRLICHLSVKPAILNFFGGIHGGAIAAFSERMAIACARTVVAEDKEIFLGELGISYLSAAPHNWKKCDCG  126 (130)
Q Consensus        47 ~gi~i~~~~~g~v~~~l~v~~~~~N~~G~vHGG~iatl~D~a~g~a~~~~~~~~~~~~T~~l~i~fl~p~~~g~~~~~~~  126 (130)
                      +|+++.++++|+++++++++++|+|+.|.+|||++++|+|.++++++....+.+..++|+|++++|+||++.|+.+++++
T Consensus        25 LGi~~~~~~~g~~~~~~~v~~~~~n~~g~~HGG~iatl~D~~~~~a~~~~~~~~~~~vT~~l~v~flrp~~~g~l~a~a~  104 (138)
T d1vh9a_          25 LGIVYTRLGDDVLEAEMPVDTRTHQPFGLLHGGASAALAETLGSMAGFMMTRDGQCVVGTELNATHHRPVSEGKVRGVCQ  104 (138)
T ss_dssp             TTCEEEEECSSCEEEEEECSTTTBCTTSSBCHHHHHHHHHHHHHHHHHTTCCTTCCEEEEEEEEEECSCCCSSEEEEEEE
T ss_pred             cCCEEEEEeCCEEEEEEEcCHHHcCCCCceecchhhhhHHHHHHHHHHhhccccccccccccceeEEeccCCCeEEEEEE
Confidence            49999999999999999999999999999999999999999999999887777778899999999999999999888887


Q ss_pred             ee
Q 032902          127 CS  128 (130)
Q Consensus       127 ~~  128 (130)
                      +-
T Consensus       105 v~  106 (138)
T d1vh9a_         105 PL  106 (138)
T ss_dssp             EE
T ss_pred             EE
Confidence            63
>d1zkia1 d.38.1.5 (A:4-129) Hypothetical protein PA5202 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1sc0a_ d.38.1.5 (A:) Hypothetical protein HI1161 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2f0xa1 d.38.1.5 (A:3-138) Hypothetical protein Them2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vh5a_ d.38.1.5 (A:) Hypothetical protein YdiI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q4ua_ d.38.1.5 (A:) 4-hydroxybenzoyl CoA thioesterase {Arthrobacter sp., strain su [TaxId: 1667]} Back     information, alignment and structure
>d2fs2a1 d.38.1.5 (A:1-131) Phenylacetic acid degradation protein PaaI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yoca1 d.38.1.5 (A:1-145) Hypothetical protein PA1835 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1wlua1 d.38.1.5 (A:2-117) Phenylacetic acid degradation protein PaaI {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ixla_ d.38.1.5 (A:) Hypothetical protein PH1136 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2hboa1 d.38.1.5 (A:12-153) Hypothetical protein CC3309 {Caulobacter crescentus [TaxId: 155892]} Back     information, alignment and structure
>d1t82a_ d.38.1.5 (A:) Putative thioesterase SO4397 {Shewanella oneidensis [TaxId: 70863]} Back     information, alignment and structure
>d1sh8a_ d.38.1.5 (A:) Hypothetical protein PA5026 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2f41a1 d.38.1.5 (A:73-183) Transcription factor FapR, C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2ov9a1 d.38.1.5 (A:7-209) Hypothetical protein RHA1_ro05818 {Rhodococcus sp. RHA1 [TaxId: 101510]} Back     information, alignment and structure
>d1ylia1 d.38.1.1 (A:11-152) Putative acyl-coa thioester hydrolase HI0827 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2gvha2 d.38.1.1 (A:147-262) Probable acyl-CoA hydrolase AGR_L_2016 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1y7ua1 d.38.1.1 (A:8-171) Acyl-coa hydrolase BC2038 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2gvha1 d.38.1.1 (A:9-143) Probable acyl-CoA hydrolase AGR_L_2016 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1vpma_ d.38.1.1 (A:) Acyl-CoA hydrolase BH0798 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1lo7a_ d.38.1.1 (A:) 4-hydroxybenzoyl-CoA thioesterase {Pseudomonas sp., CBS-3 [TaxId: 306]} Back     information, alignment and structure
>d2cwza1 d.38.1.7 (A:1-138) Hypothetical protein TTHA0967 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2fuja1 d.38.1.1 (A:5-122) Hypothetical protein XCC1147 {Xanthomonas campestris pv. campestris [TaxId: 340]} Back     information, alignment and structure
>d1s5ua_ d.38.1.1 (A:) Hypothetical protein YbgC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hx5a1 d.38.1.1 (A:1-144) Hypothetical protein PMT2055 {Prochlorococcus marinus [TaxId: 1219]} Back     information, alignment and structure
>d2q78a1 d.38.1.7 (A:1-130) Uncharacterized protein TM0581 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1njka_ d.38.1.1 (A:) Hypothetical protein YbaW {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z54a1 d.38.1.1 (A:1-132) Probable thioesterase TTHA0908 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2cyea1 d.38.1.1 (A:1-132) Probable thioesterase TTHA1846 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2hlja1 d.38.1.1 (A:1-156) Hypothetical protein PP0301 {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2alia1 d.38.1.1 (A:5-134) Hypothetical protein PA2801 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2oafa1 d.38.1.1 (A:1-143) Hypothetical protein Jann0674 {Jannaschia sp. ccs1 [TaxId: 290400]} Back     information, alignment and structure
>d2oiwa1 d.38.1.1 (A:1-131) GK1870 orthologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2nuja1 d.38.1.1 (A:3-161) Hypothetical protein Jann_1972 {Jannaschia sp. CCS1 [TaxId: 290400]} Back     information, alignment and structure
>d2essa1 d.38.1.8 (A:1-149) Acyl-ACP thioesterase {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d2o5ua1 d.38.1.1 (A:5-143) Hypothetical thioesterase PA5185 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2gf6a1 d.38.1.1 (A:1-134) Hypothetical protein SSO2295 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2owna1 d.38.1.8 (A:3-149) Putative oleoyl-ACP thioesterase LP0708 {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d2owna2 d.38.1.8 (A:150-258) Putative oleoyl-ACP thioesterase LP0708 {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d2bi0a2 d.38.1.4 (A:186-337) Hypothetical protein Rv0216/MT0226 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2c2ia1 d.38.1.4 (A:2-150) Hypothetical protein Rv0130 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1iq6a_ d.38.1.4 (A:) (R)-specific enoyl-CoA hydratase {Aeromonas caviae [TaxId: 648]} Back     information, alignment and structure
>d1s9ca1 d.38.1.4 (A:164-289) 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2essa2 d.38.1.8 (A:150-247) Acyl-ACP thioesterase {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1tbua1 d.38.1.3 (A:13-116) Peroxisomal long-chain acyl-CoA thioesterase 1, TES1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bi0a1 d.38.1.4 (A:8-185) Hypothetical protein Rv0216/MT0226 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure