Citrus Sinensis ID: 032904

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130
MANRPQIRTAASALIAMIADEDTVVGFLLAGVGNVDLRRKTNYLIVDSKTTIKQIEDAFKEFTSREDIAIVLISQYVANRIRFLVDSHNKPIPAILEIPSKDHPYDPAQDSVLSRVKNLVSVESVASDRR
ccccHHHccccccEEEEEEcHHHHHHHHHHccccccccccccEEEEcccccHHHHHHHHHHHHccccEEEEEEcHHHHHHHHHHHHHccccccEEEEcccccccccccccHHHHHHHHHHcccccccccc
**********ASALIAMIADEDTVVGFLLAGVGNVDLRRKTNYLIVDSKTTIKQIEDAFKEFTSREDIAIVLISQYVANRIRFLVDSHNKPIPAILEIPS************LSRVKNLVSVES******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MANRPQIRTAASALIAMIADEDTVVGFLLAGVGNVDLRRKTNYLIVDSKTTIKQIEDAFKEFTSREDIAIVLISQYVANRIRFLVDSHNKPIPAILEIPSKDHPYDPAQDSVLSRVKNLVSVESVASDRR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
V-type proton ATPase subunit F Subunit of the peripheral V1 complex of vacuolar ATPase essential for assembly or catalytic function. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.confidentQ9ZQX4
V-type proton ATPase subunit F Subunit of the peripheral V1 complex of vacuolar ATPase essential for assembly or catalytic function. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.probableP39111
Probable V-type proton ATPase subunit F Subunit of the peripheral V1 complex of vacuolar ATPase essential for assembly or catalytic function. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.probableQ23680

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2QAI, chain A
Confidence level:very confident
Coverage over the Query: 16-120
View the alignment between query and template
View the model in PyMOL