Citrus Sinensis ID: 032928

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130
MALRMWASSTANALRISCASKTPAFALSRCFSSVLDGLKYASSHEWVKHEGSVATVGITDHAQDHLGEVVFVELPETGASVKQGGGFGVVESVKATSDVNSPISGEVIEVNTKLTETPGLVIFSVNSFTL
ccccccHHHccHHHHHccccccccHHHHcccccccccccccccccEEEEEccEEEEcccHHHHHHcccEEEEEccccccEECccccEEEEEEEECccEEcccccEEEEEEcccccccccccccccccccc
************ALRISCASKTPAFALSRCFSSVLDGLKYASSHEWVKHEGSVATVGITDHAQDHLGEVVFVELPETGASVKQGGGFGVVESVKATSDVNSPISGEVIEVNTKLTETPGLVIFSVN****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MALRMWASSTANALRISCASKTPAFALSRCFSSVLDGLKYASSHEWVKHEGSVATVGITDHAQDHLGEVVFVELPETGASVKQGGGFGVVESVKATSDVNSPISGEVIEVNTKLTETPGLVIFSVNSFTL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable glycine cleavage system H protein 2, mitochondrial The glycine cleavage system catalyzes the degradation of glycine. The H protein shuttles the methylamine group of glycine from the P protein to the T protein.probableQ9LQL0
Glycine cleavage system H protein, mitochondrial The glycine cleavage system catalyzes the degradation of glycine. The H protein shuttles the methylamine group of glycine from the P protein to the T protein.probableA3C6G9
Glycine cleavage system H protein, mitochondrial The glycine cleavage system catalyzes the degradation of glycine. The H protein shuttles the methylamine group of glycine from the P protein to the T protein.probableQ39732

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1HPC, chain A
Confidence level:very confident
Coverage over the Query: 32-127
View the alignment between query and template
View the model in PyMOL