Citrus Sinensis ID: 032977

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130

MLVYQDLLTGDELLSDSFPYKEIENGILWEVEGKWVVQGAVDVDIGANPSAEGADEDEGVDDQAVKVVDIVDTFRLQEQPAFDKKQFVTYMKRFIKLLTPKLSEERQEIFKKNIEGATKFLLSKLSDLQL

cEEEEcccccccccccccccEEEcccEEEEEEEEEEEEccccEEccccccccccccccccccccEEEccEEEcccccccccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHccccccc

MLVYQDLLTGDELLSDSFPYKEIENGILWEVEGKWVVQGAVDVDIGAN**************QAVKVVDIVDTFRLQEQPAFDKKQFVTYMKRFIKLLTPKLSEERQEIFKKNIEGATKFLLSKLSDLQL

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MLVYQDLLTGDELLSDSFPYKEIENGILWEVEGKWVVQGAVDVDIGANPSAEGADEDEGVDDQAVKVVDIVDTFRLQEQPAFDKKQFVTYMKRFIKLLTPKLSEERQEIFKKNIEGATKFLLSKLSDLQL

Annotation	Function Description	Confidence Level	Reference Protein
Translationally-controlled tumor protein homolog	Involved in calcium binding and microtubule stabilization.	probable	Q9ZSW9
Translationally-controlled tumor protein homolog	Involved in calcium binding and microtubule stabilization.	probable	P35681
Translationally-controlled tumor protein homolog	Involved in calcium binding and microtubule stabilization.	probable	P31265

No EC number assigned to the protein, probably not an enzyme!

Template: 2KWB, chain A
Confidence level:very confident
Coverage over the Query: 1-130
View the alignment between query and template
View the model in PyMOL