Citrus Sinensis ID: 032980

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------13
MGRRILNNALRAIVNAERRGKATVELQPISTVMSSFLNIMKYRGYVKDFQVYDPHRVGKIKVELLGRVNDCRALTYRQDIKASEIEGYTVRALPTRQWGYVVITTPDGVLDHEEALRRNVGGQVLGYFH
ccccHHHHHHHHHHHHHHccccEEEEEcccHHHHHHHHHHHHcccccEEEEEccccccEEEEEEEccccccccccccCCccccccccccccccccccccEEEEEcccccccHHHHHHcccccEEEEEEc
*GRRILNNALRAIVNAERRGKATVELQPISTVMSSFLNIMKYRGYVKDFQVYDPHRVGKIKVELLGRVNDCRALTYRQDIKASEIEGYTVRALPTRQWGYVVITTPDGVLDHEEALRRNVGGQVLGYFH
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGRRILNNALRAIVNAERRGKATVELQPISTVMSSFLNIMKYRGYVKDFQVYDPHRVGKIKVELLGRVNDCRALTYRQDIKASEIEGYTVRALPTRQWGYVVITTPDGVLDHEEALRRNVGGQVLGYFH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
40S ribosomal protein S15a-5 confidentQ9M0E0
30S ribosomal protein S8 One of the primary rRNA binding proteins, it binds directly to 16S rRNA central domain where it helps coordinate assembly of the platform of the 30S subunit.probableB6YSM9
30S ribosomal protein S8 One of the primary rRNA binding proteins, it binds directly to 16S rRNA central domain where it helps coordinate assembly of the platform of the 30S subunit.probableB9LSR2

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2XZM, chain H
Confidence level:very confident
Coverage over the Query: 2-129
View the alignment between query and template
View the model in PyMOL