Citrus Sinensis ID: 032989

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------13
MVSFFFFTIICYHCILRSAAETKVPARGKALVPTDLSIAIPEGTYARIAPRSGLAWKHSMDVGAGVIDADYRGPVGVILFNHSDVDFVVKVGDRIAQLIIEKIVTPDVLEVENLDSTVRGEGGFGSTGV
ccccccccccccccEEECcccEEEccccEEEEcccEEEEcccccEEEEEccccHHHccccccccccccccccCEEEEEEEEcccccEEEEcccEEEEEEEEEECcccEEECcccccccccccccccccc
*VSFFFFTIICYHCILRSAAETKVPARGKALVPTDLSIAIPEGTYARIAPRSGLAWKHSMDVGAGVIDADYRGPVGVILFNHSDVDFVVKVGDRIAQLIIEKIVTPDVLEVENLDSTVRGEGGFG*TG*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVSFFFFTIICYHCILRSAAETKVPARGKALVPTDLSIAIPEGTYARIAPRSGLAWKHSMDVGAGVIDADYRGPVGVILFNHSDVDFVVKVGDRIAQLIIEKIVTPDVLEVENLDSTVRGEGGFGSTGV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable deoxyuridine 5'-triphosphate nucleotidohydrolase This enzyme is involved in nucleotide metabolism: it produces dUMP, the immediate precursor of thymidine nucleotides and it decreases the intracellular concentration of dUTP so that uracil cannot be incorporated into DNA.confidentQ9P6Q5
Deoxyuridine 5'-triphosphate nucleotidohydrolase This enzyme is involved in nucleotide metabolism: it produces dUMP, the immediate precursor of thymidine nucleotides and it decreases the intracellular concentration of dUTP, preventing uracil incorporation into DNA.probableQ10FF9
Deoxyuridine 5'-triphosphate nucleotidohydrolase This enzyme is involved in nucleotide metabolism: it produces dUMP, the immediate precursor of thymidine nucleotides and it decreases the intracellular concentration of dUTP so that uracil cannot be incorporated into DNA.probableQ54BW5

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.6.-.-Acting on acid anhydrides.probable
3.6.1.-In phosphorous-containing anhydrides.probable
3.6.1.23dUTP diphosphatase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3SO2, chain A
Confidence level:very confident
Coverage over the Query: 6-116
View the alignment between query and template
View the model in PyMOL