Citrus Sinensis ID: 032989

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------13
MVSFFFFTIICYHCILRSAAETKVPARGKALVPTDLSIAIPEGTYARIAPRSGLAWKHSMDVGAGVIDADYRGPVGVILFNHSDVDFVVKVGDRIAQLIIEKIVTPDVLEVENLDSTVRGEGGFGSTGV
ccccccccccccccEEEEcccEEEccccEEEEcccEEEEcccccEEEEEccccHHHccccccccccccccccEEEEEEEEEcccccEEEEcccEEEEEEEEEEEcccEEEEcccccccccccccccccc
cccHHHHHHccccEEEEccccEEEcccEEEEEEccEEEEccccEEEEEEccHHHHHHHcEEEEccEEcccEccccEEEEEEcccccEEEccccEEEEEEEEEEcccEEEEccccccccccccccccccc
MVSFFFFTIICYHCILrsaaetkvpargkalvptdlsiaipegtyariaprsglawkhsmdvgagvidadyrgpvGVILFNHSDVDFVVKVGDRIAQLIIEkivtpdvlevenldstvrgeggfgstgv
MVSFFFFTIICYHCILRSAAEtkvpargkalvptdlsiaipegTYARIAPRSGLAWKHSMDVGAGVIDADYRGPVGVILFNHSDVDFVVKVGDRIAQLiiekivtpdvlevenldstvrgeggfgstgv
MVSFFFFTIICYHCILRSAAETKVPARGKALVPTDLSIAIPEGTYARIAPRSGLAWKHSMDVGAGVIDADYRGPVGVILFNHSDVDFVVKVGDRIAQLIIEKIVTPDVLEVENLDSTVRGEGGFGSTGV
**SFFFFTIICYHCILRSAAETKVPARGKALVPTDLSIAIPEGTYARIAPRSGLAWKHSMDVGAGVIDADYRGPVGVILFNHSDVDFVVKVGDRIAQLIIEKIVTPDVLEV******************
*VSFFFFTIICYHCILRSAAETKVPARGKALVPTDLSIAIPEGTYARIAPRSGLAWKHSMDVGAGVIDADYRGPVGVILFNHSDVDFVVKVGDRIAQLIIEKIVTPDVLEVENLDSTVRGEGGFG*TG*
MVSFFFFTIICYHCILRSAAETKVPARGKALVPTDLSIAIPEGTYARIAPRSGLAWKHSMDVGAGVIDADYRGPVGVILFNHSDVDFVVKVGDRIAQLIIEKIVTPDVLEVENLDSTVRGEGGFGSTGV
*VSFFFFTIICYHCILRSAAETKVPARGKALVPTDLSIAIPEGTYARIAPRSGLAWKHSMDVGAGVIDADYRGPVGVILFNHSDVDFVVKVGDRIAQLIIEKIVTPDVLEVEN****************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVSFFFFTIICYHCILRSAAETKVPARGKALVPTDLSIAIPEGTYARIAPRSGLAWKHSMDVGAGVIDADYRGPVGVILFNHSDVDFVVKVGDRIAQLIIEKIVTPDVLEVENLDSTVRGEGGFGSTGV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query129 2.2.26 [Sep-21-2011]
P32518169 Deoxyuridine 5'-triphosph N/A no 0.883 0.674 0.859 2e-52
Q9STG6166 Deoxyuridine 5'-triphosph yes no 0.883 0.686 0.868 2e-52
Q10FF9171 Deoxyuridine 5'-triphosph yes no 0.883 0.666 0.859 6e-51
Q54BW5179 Deoxyuridine 5'-triphosph yes no 0.883 0.636 0.736 4e-42
Q9P6Q5140 Probable deoxyuridine 5'- yes no 0.883 0.814 0.728 4e-41
C4YFC7159 Deoxyuridine 5'-triphosph N/A no 0.875 0.710 0.634 4e-36
P0CY19159 Deoxyuridine 5'-triphosph N/A no 0.875 0.710 0.634 4e-36
Q6C141157 Deoxyuridine 5'-triphosph yes no 0.883 0.726 0.620 1e-35
Q6BRN7160 Deoxyuridine 5'-triphosph yes no 0.860 0.693 0.610 3e-35
P70583205 Deoxyuridine 5'-triphosph no no 0.875 0.551 0.637 3e-34
>sp|P32518|DUT_SOLLC Deoxyuridine 5'-triphosphate nucleotidohydrolase OS=Solanum lycopersicum PE=2 SV=1 Back     alignment and function desciption
 Score =  204 bits (518), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 98/114 (85%), Positives = 110/114 (96%)

Query: 16  LRSAAETKVPARGKALVPTDLSIAIPEGTYARIAPRSGLAWKHSMDVGAGVIDADYRGPV 75
           L SAAETKVPARGKALVPTDLSIA+P+GTYARIAPRSGLAWK+S+DVGAGVIDADYRGPV
Sbjct: 56  LSSAAETKVPARGKALVPTDLSIAVPQGTYARIAPRSGLAWKYSIDVGAGVIDADYRGPV 115

Query: 76  GVILFNHSDVDFVVKVGDRIAQLIIEKIVTPDVLEVENLDSTVRGEGGFGSTGV 129
           GV+LFNHS+VDF VKVGDRIAQLI++KIVTP+V +V++LDSTVRG GGFGSTGV
Sbjct: 116 GVVLFNHSEVDFEVKVGDRIAQLIVQKIVTPEVEQVDDLDSTVRGSGGFGSTGV 169
This enzyme is involved in nucleotide metabolism: it produces dUMP, the immediate precursor of thymidine nucleotides and it decreases the intracellular concentration of dUTP so that uracil cannot be incorporated into DNA. It may have as well a metabolic role in merismatic cells.
Solanum lycopersicum (taxid: 4081)
EC: 3EC: .EC: 6EC: .EC: 1EC: .EC: 2EC: 3
>sp|Q9STG6|DUT_ARATH Deoxyuridine 5'-triphosphate nucleotidohydrolase OS=Arabidopsis thaliana GN=DUT PE=1 SV=1 Back     alignment and function description
>sp|Q10FF9|DUT_ORYSJ Deoxyuridine 5'-triphosphate nucleotidohydrolase OS=Oryza sativa subsp. japonica GN=DUT PE=2 SV=1 Back     alignment and function description
>sp|Q54BW5|DUT_DICDI Deoxyuridine 5'-triphosphate nucleotidohydrolase OS=Dictyostelium discoideum GN=dut PE=3 SV=1 Back     alignment and function description
>sp|Q9P6Q5|DUT_SCHPO Probable deoxyuridine 5'-triphosphate nucleotidohydrolase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC644.05c PE=3 SV=1 Back     alignment and function description
>sp|C4YFC7|DUT_CANAW Deoxyuridine 5'-triphosphate nucleotidohydrolase OS=Candida albicans (strain WO-1) GN=DUT1 PE=3 SV=1 Back     alignment and function description
>sp|P0CY19|DUT_CANAL Deoxyuridine 5'-triphosphate nucleotidohydrolase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DUT1 PE=3 SV=1 Back     alignment and function description
>sp|Q6C141|DUT_YARLI Deoxyuridine 5'-triphosphate nucleotidohydrolase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DUT1 PE=3 SV=1 Back     alignment and function description
>sp|Q6BRN7|DUT_DEBHA Deoxyuridine 5'-triphosphate nucleotidohydrolase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DUT1 PE=3 SV=1 Back     alignment and function description
>sp|P70583|DUT_RAT Deoxyuridine 5'-triphosphate nucleotidohydrolase OS=Rattus norvegicus GN=Dut PE=2 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query129
224070184170 predicted protein [Populus trichocarpa] 0.883 0.670 0.885 9e-52
302142481176 unnamed protein product [Vitis vinifera] 0.883 0.647 0.894 3e-51
225458307 242 PREDICTED: deoxyuridine 5'-triphosphate 0.883 0.471 0.894 3e-51
147862089176 hypothetical protein VITISV_008069 [Viti 0.883 0.647 0.894 5e-51
449469995223 PREDICTED: deoxyuridine 5'-triphosphate 0.883 0.511 0.868 9e-51
297819298178 hypothetical protein ARALYDRAFT_905922 [ 0.883 0.640 0.877 1e-50
350539233169 deoxyuridine 5'-triphosphate nucleotidoh 0.883 0.674 0.859 1e-50
359479127176 PREDICTED: deoxyuridine 5'-triphosphate 0.883 0.647 0.877 1e-50
167013261169 Chain A, Structure Of Dutpase From Arabi 0.883 0.674 0.868 1e-50
15232681166 dUTP pyrophosphatase [Arabidopsis thalia 0.883 0.686 0.868 1e-50
>gi|224070184|ref|XP_002303134.1| predicted protein [Populus trichocarpa] gi|118485217|gb|ABK94469.1| unknown [Populus trichocarpa] gi|222844860|gb|EEE82407.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  207 bits (528), Expect = 9e-52,   Method: Compositional matrix adjust.
 Identities = 101/114 (88%), Positives = 109/114 (95%)

Query: 16  LRSAAETKVPARGKALVPTDLSIAIPEGTYARIAPRSGLAWKHSMDVGAGVIDADYRGPV 75
           L SA++ KVPARGKAL+PTDLSIAIPEGTYARIAPRSGL WKHS+DVGAGVIDADYRGPV
Sbjct: 57  LSSASKAKVPARGKALIPTDLSIAIPEGTYARIAPRSGLTWKHSIDVGAGVIDADYRGPV 116

Query: 76  GVILFNHSDVDFVVKVGDRIAQLIIEKIVTPDVLEVENLDSTVRGEGGFGSTGV 129
           GVILFNHSDVDF VKVGDRIAQLIIEKIVTP+V+EVE+LD+TVRG GGFGSTGV
Sbjct: 117 GVILFNHSDVDFEVKVGDRIAQLIIEKIVTPNVMEVEDLDATVRGAGGFGSTGV 170

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|302142481|emb|CBI19684.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225458307|ref|XP_002282840.1| PREDICTED: deoxyuridine 5'-triphosphate nucleotidohydrolase-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147862089|emb|CAN82958.1| hypothetical protein VITISV_008069 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449469995|ref|XP_004152704.1| PREDICTED: deoxyuridine 5'-triphosphate nucleotidohydrolase-like [Cucumis sativus] gi|449496082|ref|XP_004160033.1| PREDICTED: deoxyuridine 5'-triphosphate nucleotidohydrolase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|297819298|ref|XP_002877532.1| hypothetical protein ARALYDRAFT_905922 [Arabidopsis lyrata subsp. lyrata] gi|297323370|gb|EFH53791.1| hypothetical protein ARALYDRAFT_905922 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|350539233|ref|NP_001233870.1| deoxyuridine 5'-triphosphate nucleotidohydrolase [Solanum lycopersicum] gi|416922|sp|P32518.1|DUT_SOLLC RecName: Full=Deoxyuridine 5'-triphosphate nucleotidohydrolase; Short=dUTPase; AltName: Full=P18; AltName: Full=dUTP pyrophosphatase gi|251897|gb|AAB22611.1| deoxyuridine triphosphatase [Solanum lycopersicum] Back     alignment and taxonomy information
>gi|359479127|ref|XP_002263269.2| PREDICTED: deoxyuridine 5'-triphosphate nucleotidohydrolase-like [Vitis vinifera] gi|296083887|emb|CBI24275.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|167013261|pdb|2P9O|A Chain A, Structure Of Dutpase From Arabidopsis Thaliana gi|167013262|pdb|2P9O|B Chain B, Structure Of Dutpase From Arabidopsis Thaliana gi|167013263|pdb|2P9O|C Chain C, Structure Of Dutpase From Arabidopsis Thaliana gi|167744878|pdb|2PC5|A Chain A, Native Crystal Structure Analysis On Arabidopsis Dutpase gi|167744879|pdb|2PC5|B Chain B, Native Crystal Structure Analysis On Arabidopsis Dutpase gi|167744880|pdb|2PC5|C Chain C, Native Crystal Structure Analysis On Arabidopsis Dutpase Back     alignment and taxonomy information
>gi|15232681|ref|NP_190278.1| dUTP pyrophosphatase [Arabidopsis thaliana] gi|75266320|sp|Q9STG6.1|DUT_ARATH RecName: Full=Deoxyuridine 5'-triphosphate nucleotidohydrolase; Short=dUTPase; AltName: Full=dUTP pyrophosphatase; AltName: Full=dUTP-pyrophosphatase-like 1; Short=AtDUT1 gi|13878143|gb|AAK44149.1|AF370334_1 putative dUTP pyrophosphatase [Arabidopsis thaliana] gi|5541665|emb|CAB51171.1| dUTP pyrophosphatase-like protein [Arabidopsis thaliana] gi|17104549|gb|AAL34163.1| putative dUTP pyrophosphatase [Arabidopsis thaliana] gi|332644701|gb|AEE78222.1| dUTP pyrophosphatase [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query129
TAIR|locus:2102817166 DUT1 "DUTP-PYROPHOSPHATASE-LIK 0.883 0.686 0.868 7.4e-50
DICTYBASE|DDB_G0293374179 dut "dUTP diphosphatase" [Dict 0.883 0.636 0.736 2.6e-40
POMBASE|SPAC644.05c140 dut1 "deoxyuridine 5'-triphosp 0.883 0.814 0.728 2.3e-39
ASPGD|ASPL0000062025208 AN0271 [Emericella nidulans (t 0.875 0.543 0.672 6.3e-37
FB|FBgn0250837188 dUTPase "Deoxyuridine triphosp 0.883 0.606 0.657 4.4e-36
CGD|CAL0004091159 DUT1 [Candida albicans (taxid: 0.875 0.710 0.634 2.2e-34
UNIPROTKB|P0CY19159 DUT1 "Deoxyuridine 5'-triphosp 0.875 0.710 0.634 2.2e-34
RGD|620849205 Dut "deoxyuridine triphosphata 0.875 0.551 0.637 8.5e-33
UNIPROTKB|D4A6V3177 D4A6V3 "Uncharacterized protei 0.852 0.621 0.636 6e-32
UNIPROTKB|Q5ZKJ3166 DUT "Uncharacterized protein" 0.875 0.680 0.628 1.6e-31
TAIR|locus:2102817 DUT1 "DUTP-PYROPHOSPHATASE-LIKE 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 519 (187.8 bits), Expect = 7.4e-50, P = 7.4e-50
 Identities = 99/114 (86%), Positives = 108/114 (94%)

Query:    16 LRSAAETKVPARGKALVPTDLSIAIPEGTYARIAPRSGLAWKHSMDVGAGVIDADYRGPV 75
             L SA ++KVPARGKAL+PTDLSIA+PEGTYARIAPRSGLAWKHS+DVGAGVIDADYRGPV
Sbjct:    53 LSSAVDSKVPARGKALIPTDLSIAVPEGTYARIAPRSGLAWKHSIDVGAGVIDADYRGPV 112

Query:    76 GVILFNHSDVDFVVKVGDRIAQLIIEKIVTPDVLEVENLDSTVRGEGGFGSTGV 129
             GVILFNHSD DF VK GDRIAQLIIEKIVTPDV+EV++LD TVRG+GGFGSTGV
Sbjct:   113 GVILFNHSDADFEVKFGDRIAQLIIEKIVTPDVVEVDDLDETVRGDGGFGSTGV 166
GO:0004170 "dUTP diphosphatase activity" evidence=IEA;ISS
GO:0009394 "2'-deoxyribonucleotide metabolic process" evidence=ISS
GO:0016787 "hydrolase activity" evidence=IEA
GO:0046080 "dUTP metabolic process" evidence=IEA
GO:0000287 "magnesium ion binding" evidence=IDA
GO:0042802 "identical protein binding" evidence=IPI
GO:0006281 "DNA repair" evidence=IMP
GO:0005829 "cytosol" evidence=IDA
GO:0006261 "DNA-dependent DNA replication" evidence=RCA
DICTYBASE|DDB_G0293374 dut "dUTP diphosphatase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
POMBASE|SPAC644.05c dut1 "deoxyuridine 5'-triphosphate nucleotidohydrolase (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
ASPGD|ASPL0000062025 AN0271 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
FB|FBgn0250837 dUTPase "Deoxyuridine triphosphatase" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
CGD|CAL0004091 DUT1 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
UNIPROTKB|P0CY19 DUT1 "Deoxyuridine 5'-triphosphate nucleotidohydrolase" [Candida albicans SC5314 (taxid:237561)] Back     alignment and assigned GO terms
RGD|620849 Dut "deoxyuridine triphosphatase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|D4A6V3 D4A6V3 "Uncharacterized protein" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZKJ3 DUT "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q10FF9DUT_ORYSJ3, ., 6, ., 1, ., 2, 30.85960.88370.6666yesno
Q6CQN7DUT_KLULA3, ., 6, ., 1, ., 2, 30.60370.81390.7094yesno
Q74ZF0DUT_ASHGO3, ., 6, ., 1, ., 2, 30.60370.81390.6862yesno
P32518DUT_SOLLC3, ., 6, ., 1, ., 2, 30.85960.88370.6745N/Ano
Q6C141DUT_YARLI3, ., 6, ., 1, ., 2, 30.62060.88370.7261yesno
B9KL02DUT_RHOSK3, ., 6, ., 1, ., 2, 30.54360.78290.6516yesno
B3QML1DUT_CHLP83, ., 6, ., 1, ., 2, 30.53920.77510.6666yesno
A4YJH3DUT_BRASO3, ., 6, ., 1, ., 2, 30.50490.76740.6513yesno
Q54BW5DUT_DICDI3, ., 6, ., 1, ., 2, 30.73680.88370.6368yesno
Q9STG6DUT_ARATH3, ., 6, ., 1, ., 2, 30.86840.88370.6867yesno
B0C9N7DUT_ACAM13, ., 6, ., 1, ., 2, 30.53460.76740.6923yesno
O52597DUT_BRAJA3, ., 6, ., 1, ., 2, 30.54450.76740.6513yesno
Q9P6Q5DUT_SCHPO3, ., 6, ., 1, ., 2, 30.72800.88370.8142yesno
Q6BRN7DUT_DEBHA3, ., 6, ., 1, ., 2, 30.61060.86040.6937yesno
P33317DUT_YEAST3, ., 6, ., 1, ., 2, 30.54460.86040.7551yesno
O68992DUT_CHLTE3, ., 6, ., 1, ., 2, 30.51780.85270.7236yesno
P17374DUT_VACCW3, ., 6, ., 1, ., 2, 30.52630.87590.7687yesno
B1WN93DUT_CYAA53, ., 6, ., 1, ., 2, 30.48270.88370.8028yesno
Q2J2H6DUT_RHOP23, ., 6, ., 1, ., 2, 30.530.75960.6447yesno
Q13EP1DUT_RHOPS3, ., 6, ., 1, ., 2, 30.540.75960.6447yesno
Q6FKQ6DUT_CANGA3, ., 6, ., 1, ., 2, 30.58920.86040.7708yesno
P61908DUT_GEOSL3, ., 6, ., 1, ., 2, 30.51960.77510.6711yesno
Q39V99DUT_GEOMG3, ., 6, ., 1, ., 2, 30.52940.77510.6756yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.6.10.976
3rd Layer3.6.1.230.991

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
estExt_fgenesh4_pg.C_LG_II2596
SubName- Full=Putative uncharacterized protein; (171 aa)
(Populus trichocarpa)
Predicted Functional Partners:
gw1.I.2892.1
thymidylate kinase (EC-2.7.4.9) (210 aa)
   • •• 0.964
DHFR-TS-2
dihydrofolate reductase-thymidylate synthase (EC-1.5.1.3 2.1.1.45) (414 aa)
   • •• 0.933
eugene3.00400106
RecName- Full=Nucleoside diphosphate kinase; EC=2.7.4.6; (149 aa)
     •• 0.915
fgenesh4_pg.C_LG_XII000913
hypothetical protein (152 aa)
     •• 0.913
gw1.II.1445.1
SubName- Full=Putative uncharacterized protein; (164 aa)
     •• 0.913
estExt_Genewise1_v1.C_LG_III1530
nucleoside diphosphate kinase family protein (EC-2.7.4.6) (174 aa)
     •  0.911
grail3.0008036902
nucleoside-diphosphate kinase (EC-2.7.4.6) (237 aa)
     •  0.907
eugene3.00031128
RecName- Full=Nucleoside diphosphate kinase; EC=2.7.4.6; (236 aa)
     •  0.907
eugene3.00120910
hypothetical protein (225 aa)
•    •• 0.906
eugene3.00150755
SubName- Full=Putative uncharacterized protein; (229 aa)
     •• 0.905

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query129
PLN02547157 PLN02547, PLN02547, dUTP pyrophosphatase 1e-77
TIGR00576141 TIGR00576, dut, deoxyuridine 5'-triphosphate nucle 5e-59
COG0756148 COG0756, Dut, dUTPase [Nucleotide transport and me 2e-50
PHA02703165 PHA02703, PHA02703, ORF007 dUTPase; Provisional 2e-46
PRK00601150 PRK00601, dut, deoxyuridine 5'-triphosphate nucleo 1e-44
PHA03094144 PHA03094, PHA03094, dUTPase; Provisional 2e-44
pfam00692129 pfam00692, dUTPase, dUTPase 2e-43
cd0755792 cd07557, trimeric_dUTPase, Trimeric dUTP diphospha 3e-27
PTZ00143155 PTZ00143, PTZ00143, deoxyuridine 5'-triphosphate n 8e-14
COG0717183 COG0717, Dcd, Deoxycytidine deaminase [Nucleotide 2e-08
PHA03124418 PHA03124, PHA03124, dUTPase; Provisional 4e-04
TIGR02274179 TIGR02274, dCTP_deam, deoxycytidine triphosphate d 0.001
PRK02253167 PRK02253, PRK02253, deoxyuridine 5'-triphosphate n 0.001
PRK13956147 PRK13956, dut, deoxyuridine 5'-triphosphate nucleo 0.002
>gnl|CDD|215302 PLN02547, PLN02547, dUTP pyrophosphatase Back     alignment and domain information 
 Score =  225 bits (576), Expect = 1e-77
 Identities = 102/114 (89%), Positives = 109/114 (95%)

Query: 16  LRSAAETKVPARGKALVPTDLSIAIPEGTYARIAPRSGLAWKHSMDVGAGVIDADYRGPV 75
           L SA +T VPARGKALVPTDLSIAIPEGTYARIAPRSGLAWKHS+DVGAGVIDADYRGPV
Sbjct: 41  LSSAYDTVVPARGKALVPTDLSIAIPEGTYARIAPRSGLAWKHSIDVGAGVIDADYRGPV 100

Query: 76  GVILFNHSDVDFVVKVGDRIAQLIIEKIVTPDVLEVENLDSTVRGEGGFGSTGV 129
           GVILFNHSDVDF VKVGDRIAQLI+EKIVTP+V+EVE+LD+TVRG GGFGSTGV
Sbjct: 101 GVILFNHSDVDFEVKVGDRIAQLILEKIVTPEVVEVEDLDATVRGAGGFGSTGV 154

Length = 157
>gnl|CDD|129666 TIGR00576, dut, deoxyuridine 5'-triphosphate nucleotidohydrolase (dut) Back     alignment and domain information
>gnl|CDD|223827 COG0756, Dut, dUTPase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|165079 PHA02703, PHA02703, ORF007 dUTPase; Provisional Back     alignment and domain information
>gnl|CDD|234802 PRK00601, dut, deoxyuridine 5'-triphosphate nucleotidohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|165376 PHA03094, PHA03094, dUTPase; Provisional Back     alignment and domain information
>gnl|CDD|201398 pfam00692, dUTPase, dUTPase Back     alignment and domain information
>gnl|CDD|143638 cd07557, trimeric_dUTPase, Trimeric dUTP diphosphatases Back     alignment and domain information
>gnl|CDD|240288 PTZ00143, PTZ00143, deoxyuridine 5'-triphosphate nucleotidohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|223789 COG0717, Dcd, Deoxycytidine deaminase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|165396 PHA03124, PHA03124, dUTPase; Provisional Back     alignment and domain information
>gnl|CDD|233806 TIGR02274, dCTP_deam, deoxycytidine triphosphate deaminase Back     alignment and domain information
>gnl|CDD|179395 PRK02253, PRK02253, deoxyuridine 5'-triphosphate nucleotidohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|184417 PRK13956, dut, deoxyuridine 5'-triphosphate nucleotidohydrolase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 129
COG0756148 Dut dUTPase [Nucleotide transport and metabolism] 100.0
PHA03094144 dUTPase; Provisional 100.0
PLN02547157 dUTP pyrophosphatase 100.0
PHA02703165 ORF007 dUTPase; Provisional 100.0
TIGR00576141 dut deoxyuridine 5'-triphosphate nucleotidohydrola 100.0
PRK00601150 dut deoxyuridine 5'-triphosphate nucleotidohydrola 100.0
PTZ00143155 deoxyuridine 5'-triphosphate nucleotidohydrolase; 100.0
PRK13956147 dut deoxyuridine 5'-triphosphate nucleotidohydrola 100.0
PF00692129 dUTPase: dUTPase; InterPro: IPR008180 Synonym(s): 100.0
PHA03124418 dUTPase; Provisional 100.0
KOG3370140 consensus dUTPase [Nucleotide transport and metabo 100.0
PHA03126326 dUTPase; Provisional 100.0
PHA03123402 dUTPase; Provisional 100.0
PHA03127322 dUTPase; Provisional 99.97
PHA03130368 dUTPase; Provisional 99.97
PHA03129436 dUTPase; Provisional 99.97
cd0755792 trimeric_dUTPase Trimeric dUTP diphosphatases. Tri 99.97
PHA03131286 dUTPase; Provisional 99.96
PHA01707158 dut 2'-deoxyuridine 5'-triphosphatase 99.94
TIGR02274179 dCTP_deam deoxycytidine triphosphate deaminase. Me 99.93
PHA03131 286 dUTPase; Provisional 99.93
PRK00416177 dcd deoxycytidine triphosphate deaminase; Reviewed 99.92
COG0717183 Dcd Deoxycytidine deaminase [Nucleotide transport 99.87
PRK02253167 deoxyuridine 5'-triphosphate nucleotidohydrolase; 99.87
PHA03129 436 dUTPase; Provisional 99.83
PRK07559 365 2'-deoxycytidine 5'-triphosphate deaminase; Provis 99.73
PHA03127 322 dUTPase; Provisional 99.6
PRK07559365 2'-deoxycytidine 5'-triphosphate deaminase; Provis 99.53
PHA03128376 dUTPase; Provisional 99.46
PF06559 364 DCD: 2'-deoxycytidine 5'-triphosphate deaminase (D 99.34
PHA03128 376 dUTPase; Provisional 99.32
PHA03125376 dUTPase; Provisional 99.3
PHA03125 376 dUTPase; Provisional 99.2
PHA03126 326 dUTPase; Provisional 99.01
PHA03123 402 dUTPase; Provisional 98.09
PHA03130 368 dUTPase; Provisional 97.85
PF04797379 Herpes_ORF11: Herpesvirus dUTPase protein; InterPr 97.54
PF06559364 DCD: 2'-deoxycytidine 5'-triphosphate deaminase (D 97.49
PF05784348 Herpes_UL82_83: Betaherpesvirus UL82/83 protein N 97.04
PHA03365419 hypothetical protein; Provisional 95.19
PHA03124 418 dUTPase; Provisional 86.2
PF06284530 Cytomega_UL84: Cytomegalovirus UL84 protein; Inter 85.31
PF05784 348 Herpes_UL82_83: Betaherpesvirus UL82/83 protein N 81.96
>COG0756 Dut dUTPase [Nucleotide transport and metabolism] Back     alignment and domain information 
Probab=100.00  E-value=1.2e-46  Score=268.49  Aligned_cols=124  Identities=49%  Similarity=0.782  Sum_probs=120.6

Q ss_pred             EeccCCeEEEEEcCcc-EEEcCCCEEEEEcCcEEEeCCCcEEEEEeCCCcccccceee--cceEEcCCCccceEEEEEcC
Q 032989            6 FFTIICYHCILRSAAE-TKVPARGKALVPTDLSIAIPEGTYARIAPRSGLAWKHSMDV--GAGVIDADYRGPVGVILFNH   82 (129)
Q Consensus         6 ~~t~~~aG~DL~~~~~-~~i~p~~~~li~Tg~~v~ip~g~~~~i~~RSsl~~k~gl~v--~~gvID~gY~Gei~i~l~N~   82 (129)
                      .+|+++|||||+++++ ++|+|+++.+|+||+.+.||+++++++.+||+++.|+|+.+  .+|+||+||+|||++.++|.
T Consensus        21 y~t~gsAG~DLrA~~~~~~i~pg~~~LVpTGl~~~ip~g~~~~v~PRSgla~k~Gi~~~Ns~G~IDsDYrGei~V~l~N~  100 (148)
T COG0756          21 YATEGSAGYDLRAAEDEVTIAPGERKLVPTGLAIELPEGYEAQVRPRSGLALKHGITLGNSPGTIDSDYRGEIKVLLINL  100 (148)
T ss_pred             eecCCccceeeecccceeEECCCCeEEecCCEEEEcCCCcEEEEeccccCceeceEEEecCCceECCCCCceEEEEEEeC
Confidence            5799999999999999 99999999999999999999999999999999999999876  59999999999999999999


Q ss_pred             CCCcEEeeCCCEEEEEEEeecccccEEEeccCCCccCCCCCCcccCC
Q 032989           83 SDVDFVVKVGDRIAQLIIEKIVTPDVLEVENLDSTVRGEGGFGSTGV  129 (129)
Q Consensus        83 ~~~~~~i~~G~riaQlv~~~~~~~~~~~v~~l~~t~Rg~~gfGSTG~  129 (129)
                      +++++.|++|||||||+|.|+.++++.+++++++|+||+|||||||+
T Consensus       101 ~~~~f~ie~GdRIaQ~V~~~v~~~~~~~v~~~~~t~rg~GGFGSTG~  147 (148)
T COG0756         101 GDEDFVIEKGDRIAQLVFVKVLQAEFDEVENLDETERGTGGFGSTGV  147 (148)
T ss_pred             CCCCEEecCCCEEEEEEEEEEEecceeeeecccccccccCCCCCCCc
Confidence            99999999999999999999999999999999999999999999995

>PHA03094 dUTPase; Provisional Back     alignment and domain information
>PLN02547 dUTP pyrophosphatase Back     alignment and domain information
>PHA02703 ORF007 dUTPase; Provisional Back     alignment and domain information
>TIGR00576 dut deoxyuridine 5'-triphosphate nucleotidohydrolase (dut) Back     alignment and domain information
>PRK00601 dut deoxyuridine 5'-triphosphate nucleotidohydrolase; Provisional Back     alignment and domain information
>PTZ00143 deoxyuridine 5'-triphosphate nucleotidohydrolase; Provisional Back     alignment and domain information
>PRK13956 dut deoxyuridine 5'-triphosphate nucleotidohydrolase; Provisional Back     alignment and domain information
>PF00692 dUTPase: dUTPase; InterPro: IPR008180 Synonym(s): dUTP diphosphatase, Deoxyuridine-triphosphatase The essential enzyme dUTP pyrophosphatase (3 Back     alignment and domain information
>PHA03124 dUTPase; Provisional Back     alignment and domain information
>KOG3370 consensus dUTPase [Nucleotide transport and metabolism] Back     alignment and domain information
>PHA03126 dUTPase; Provisional Back     alignment and domain information
>PHA03123 dUTPase; Provisional Back     alignment and domain information
>PHA03127 dUTPase; Provisional Back     alignment and domain information
>PHA03130 dUTPase; Provisional Back     alignment and domain information
>PHA03129 dUTPase; Provisional Back     alignment and domain information
>cd07557 trimeric_dUTPase Trimeric dUTP diphosphatases Back     alignment and domain information
>PHA03131 dUTPase; Provisional Back     alignment and domain information
>PHA01707 dut 2'-deoxyuridine 5'-triphosphatase Back     alignment and domain information
>TIGR02274 dCTP_deam deoxycytidine triphosphate deaminase Back     alignment and domain information
>PHA03131 dUTPase; Provisional Back     alignment and domain information
>PRK00416 dcd deoxycytidine triphosphate deaminase; Reviewed Back     alignment and domain information
>COG0717 Dcd Deoxycytidine deaminase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK02253 deoxyuridine 5'-triphosphate nucleotidohydrolase; Provisional Back     alignment and domain information
>PHA03129 dUTPase; Provisional Back     alignment and domain information
>PRK07559 2'-deoxycytidine 5'-triphosphate deaminase; Provisional Back     alignment and domain information
>PHA03127 dUTPase; Provisional Back     alignment and domain information
>PRK07559 2'-deoxycytidine 5'-triphosphate deaminase; Provisional Back     alignment and domain information
>PHA03128 dUTPase; Provisional Back     alignment and domain information
>PF06559 DCD: 2'-deoxycytidine 5'-triphosphate deaminase (DCD); InterPro: IPR010550 This family consists of several bacterial 2'-deoxycytidine 5'-triphosphate deaminase proteins (3 Back     alignment and domain information
>PHA03128 dUTPase; Provisional Back     alignment and domain information
>PHA03125 dUTPase; Provisional Back     alignment and domain information
>PHA03125 dUTPase; Provisional Back     alignment and domain information
>PHA03126 dUTPase; Provisional Back     alignment and domain information
>PHA03123 dUTPase; Provisional Back     alignment and domain information
>PHA03130 dUTPase; Provisional Back     alignment and domain information
>PF04797 Herpes_ORF11: Herpesvirus dUTPase protein; InterPro: IPR006882 This family of proteins are found in Herpesvirus Back     alignment and domain information
>PF06559 DCD: 2'-deoxycytidine 5'-triphosphate deaminase (DCD); InterPro: IPR010550 This family consists of several bacterial 2'-deoxycytidine 5'-triphosphate deaminase proteins (3 Back     alignment and domain information
>PF05784 Herpes_UL82_83: Betaherpesvirus UL82/83 protein N terminus; InterPro: IPR008649 This family represents the N-terminal region of the UL82 and UL83 proteins from Betaherpesvirus sp Back     alignment and domain information
>PHA03365 hypothetical protein; Provisional Back     alignment and domain information
>PHA03124 dUTPase; Provisional Back     alignment and domain information
>PF06284 Cytomega_UL84: Cytomegalovirus UL84 protein; InterPro: IPR010436 This family consists of several Cytomegalovirus UL84 proteins Back     alignment and domain information
>PF05784 Herpes_UL82_83: Betaherpesvirus UL82/83 protein N terminus; InterPro: IPR008649 This family represents the N-terminal region of the UL82 and UL83 proteins from Betaherpesvirus sp Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query129
2p9o_A169 Structure Of Dutpase From Arabidopsis Thaliana Leng 2e-53
3so2_A146 Chlorella Dutpase Length = 146 5e-40
3ecy_A160 Crystal Structural Analysis Of Drosophila Melanogas 8e-39
1q5h_A147 Human Dutp Pyrophosphatase Complex With Dudp Length 7e-34
2hqu_A164 Human Dutpase In Complex With Alpha,Beta-Iminodutp 1e-33
3c3i_A141 Evolution Of Chlorella Virus Dutpase Length = 141 3e-33
3ca9_A165 Evolution Of Chlorella Virus Dutpase Length = 165 3e-32
3c2t_A141 Evolution Of Chlorella Virus Dutpase Length = 141 4e-32
3p48_A147 Structure Of The Yeast Dutpase Dut1 In Complex With 1e-30
3f4f_A167 Crystal Structure Of Dut1p, A Dutpase From Saccharo 2e-30
2okd_A147 High Resolution Crystal Structures Of Vaccinia Viru 1e-28
2okb_A137 High Resolution Crystal Structures Of Vaccinia Viru 1e-28
3lqw_A163 Crystal Structure Of Deoxyuridine 5-Triphosphate Nu 7e-27
3mbq_A178 Crystal Structure Of Deoxyuridine 5-Triphosphate Nu 1e-19
1dup_A152 Deoxyuridine 5'-Triphosphate Nucleotido Hydrolase ( 2e-15
1euw_A152 Atomic Resolution Structure Of E. Coli Dutpase Leng 3e-15
1rnj_A152 Crystal Structure Of Inactive Mutant Dutpase Comple 7e-15
3tqz_A155 Structure Of A Deoxyuridine 5'-Triphosphate Nucleot 3e-14
3zf2_A207 Phage Dutpases Control Transfer Of Virulence Genes 3e-13
4gk6_A138 X-Ray Crystal Structure Of A Hypothetical Deoxyurid 6e-13
3zf1_A207 Phage Dutpases Control Transfer Of Virulence Genes 1e-12
3zf5_A207 Phage Dutpases Control Transfer Of Virulence Genes 1e-12
3zf0_A207 Phage Dutpases Control Transfer Of Virulence Genes 3e-12
3zf3_A207 Phage Dutpases Control Transfer Of Virulence Genes 4e-12
3zf6_A207 Phage Dutpases Control Transfer Of Virulence Genes 4e-12
3zf4_A207 Phage Dutpases Control Transfer Of Virulence Genes 4e-12
3h6d_A174 Structure Of The Mycobacterium Tuberculosis Dutpase 3e-11
1mq7_A154 Crystal Structure Of Dutpase From Mycobacterium Tub 4e-11
3loj_A174 Structure Of Mycobacterium Tuberculosis Dutpase H14 4e-11
3hza_A174 Crystal Structure Of Dutpase H145w Mutant Length = 4e-11
1six_A174 Mycobacterium Tuberculosis Dutpase Complexed With M 4e-11
3i93_A158 Crystal Structure Of Mycobacterium Tuberculosis Dut 5e-11
1sjn_A170 Mycobacterium Tuberculosis Dutpase Complexed With M 5e-11
1dut_A133 Fiv Dutp Pyrophosphatase Length = 133 2e-09
1f7d_A136 Crystal Structures Of Feline Immunodeficiency Virus 2e-09
1duc_A134 Eiav Dutpase DudpSTRONTIUM COMPLEX Length = 134 4e-09
2xcd_A144 Structure Of Yncf,The Genomic Dutpase From Bacillus 5e-09
2baz_A142 Structure Of Yoss, A Putative Dutpase From Bacillus 1e-08
3t64_A181 5'-Diphenyl Nucleoside Inhibitors Of Plasmodium Fal 4e-08
3t60_A181 5'-Diphenyl Nucleoside Inhibitors Of Plasmodium Fal 4e-08
1vyq_A173 Novel Inhibitors Of Plasmodium Falciparum Dutpase P 4e-08
2d4n_A152 Crystal Structure Of M-Pmv Dutpase Complexed With D 5e-06
2d4l_A152 Crystal Structure Of Truncated In C-Terminal M-Pmv 6e-06
>pdb|2P9O|A Chain A, Structure Of Dutpase From Arabidopsis Thaliana Length = 169 Back     alignment and structure 
Iteration: 1

 Score =  204 bits (518), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 99/114 (86%), Positives = 108/114 (94%)
Query: 16  LRSAAETKVPARGKALVPTDLSIAIPEGTYARIAPRSGLAWKHSMDVGAGVIDADYRGPV 75
           L SA ++KVPARGKAL+PTDLSIA+PEGTYARIAPRSGLAWKHS+DVGAGVIDADYRGPV
Sbjct: 56  LSSAVDSKVPARGKALIPTDLSIAVPEGTYARIAPRSGLAWKHSIDVGAGVIDADYRGPV 115
Query: 76  GVILFNHSDVDFVVKVGDRIAQLIIEKIVTPDVLEVENLDSTVRGEGGFGSTGV 129
           GVILFNHSD DF VK GDRIAQLIIEKIVTPDV+EV++LD TVRG+GGFGSTGV
Sbjct: 116 GVILFNHSDADFEVKFGDRIAQLIIEKIVTPDVVEVDDLDETVRGDGGFGSTGV 169
>pdb|3SO2|A Chain A, Chlorella Dutpase Length = 146 Back     alignment and structure
>pdb|3ECY|A Chain A, Crystal Structural Analysis Of Drosophila Melanogaster Dutpase Length = 160 Back     alignment and structure
>pdb|1Q5H|A Chain A, Human Dutp Pyrophosphatase Complex With Dudp Length = 147 Back     alignment and structure
>pdb|2HQU|A Chain A, Human Dutpase In Complex With Alpha,Beta-Iminodutp And Magnesium Ion Length = 164 Back     alignment and structure
>pdb|3C3I|A Chain A, Evolution Of Chlorella Virus Dutpase Length = 141 Back     alignment and structure
>pdb|3CA9|A Chain A, Evolution Of Chlorella Virus Dutpase Length = 165 Back     alignment and structure
>pdb|3C2T|A Chain A, Evolution Of Chlorella Virus Dutpase Length = 141 Back     alignment and structure
>pdb|3P48|A Chain A, Structure Of The Yeast Dutpase Dut1 In Complex With Dumpnpp Length = 147 Back     alignment and structure
>pdb|3F4F|A Chain A, Crystal Structure Of Dut1p, A Dutpase From Saccharomyces Cerevisiae Length = 167 Back     alignment and structure
>pdb|2OKD|A Chain A, High Resolution Crystal Structures Of Vaccinia Virus Dutpase Length = 147 Back     alignment and structure
>pdb|2OKB|A Chain A, High Resolution Crystal Structures Of Vaccinia Virus Dutpase Length = 137 Back     alignment and structure
>pdb|3LQW|A Chain A, Crystal Structure Of Deoxyuridine 5-Triphosphate Nucleotidohydrolase From Entamoeba Histolytica Length = 163 Back     alignment and structure
>pdb|3MBQ|A Chain A, Crystal Structure Of Deoxyuridine 5-Triphosphate Nucleotidohydrolase From Brucella Melitensis, Orthorhombic Crystal Form Length = 178 Back     alignment and structure
>pdb|1DUP|A Chain A, Deoxyuridine 5'-Triphosphate Nucleotido Hydrolase (D-Utpase) Length = 152 Back     alignment and structure
>pdb|1EUW|A Chain A, Atomic Resolution Structure Of E. Coli Dutpase Length = 152 Back     alignment and structure
>pdb|1RNJ|A Chain A, Crystal Structure Of Inactive Mutant Dutpase Complexed With Substrate Analogue Imido-Dutp Length = 152 Back     alignment and structure
>pdb|3TQZ|A Chain A, Structure Of A Deoxyuridine 5'-Triphosphate Nucleotidohydrolase (Dut) From Coxiella Burnetii Length = 155 Back     alignment and structure
>pdb|4GK6|A Chain A, X-Ray Crystal Structure Of A Hypothetical Deoxyuridine 5-Triphosphate Nucleotidohydrolase From Mycobacterium Abscessus Length = 138 Back     alignment and structure
>pdb|3H6D|A Chain A, Structure Of The Mycobacterium Tuberculosis Dutpase D28n Mutant Length = 174 Back     alignment and structure
>pdb|1MQ7|A Chain A, Crystal Structure Of Dutpase From Mycobacterium Tuberculosis (rv2697c) Length = 154 Back     alignment and structure
>pdb|3LOJ|A Chain A, Structure Of Mycobacterium Tuberculosis Dutpase H145a Mutant Length = 174 Back     alignment and structure
>pdb|3HZA|A Chain A, Crystal Structure Of Dutpase H145w Mutant Length = 174 Back     alignment and structure
>pdb|1SIX|A Chain A, Mycobacterium Tuberculosis Dutpase Complexed With Magnesium And Alpha, Beta-Imido-Dutp Length = 174 Back     alignment and structure
>pdb|3I93|A Chain A, Crystal Structure Of Mycobacterium Tuberculosis Dutpase Stop138t Mutant Length = 158 Back     alignment and structure
>pdb|1SJN|A Chain A, Mycobacterium Tuberculosis Dutpase Complexed With Magnesium And Alpha, Beta-Imido-Dutp Length = 170 Back     alignment and structure
>pdb|1DUT|A Chain A, Fiv Dutp Pyrophosphatase Length = 133 Back     alignment and structure
>pdb|1F7D|A Chain A, Crystal Structures Of Feline Immunodeficiency Virus Dutp Pyrophosphatase And Its Nucleotide Complexes In Three Crystal Forms Length = 136 Back     alignment and structure
>pdb|1DUC|A Chain A, Eiav Dutpase DudpSTRONTIUM COMPLEX Length = 134 Back     alignment and structure
>pdb|2XCD|A Chain A, Structure Of Yncf,The Genomic Dutpase From Bacillus Subtilis Length = 144 Back     alignment and structure
>pdb|2BAZ|A Chain A, Structure Of Yoss, A Putative Dutpase From Bacillus Subtilis Length = 142 Back     alignment and structure
>pdb|3T64|A Chain A, 5'-Diphenyl Nucleoside Inhibitors Of Plasmodium Falciparum Dutpase Length = 181 Back     alignment and structure
>pdb|3T60|A Chain A, 5'-Diphenyl Nucleoside Inhibitors Of Plasmodium Falciparum Dutpase Length = 181 Back     alignment and structure
>pdb|1VYQ|A Chain A, Novel Inhibitors Of Plasmodium Falciparum Dutpase Provide A Platform For Anti-Malarial Drug Design Length = 173 Back     alignment and structure
>pdb|2D4N|A Chain A, Crystal Structure Of M-Pmv Dutpase Complexed With Dupnpp, Substrate Analogue Length = 152 Back     alignment and structure
>pdb|2D4L|A Chain A, Crystal Structure Of Truncated In C-Terminal M-Pmv Dutpase Length = 152 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query129
2p9o_A169 DUTP pyrophosphatase-like protein; dutpase, magnes 6e-69
3ca9_A165 Deoxyuridine triphosphatase; dutpase chlorella vir 6e-69
3c2t_A141 Deoxyuridine triphosphatase; dutpase chlorella vir 1e-68
3ecy_A160 CG4584-PA, isoform A (bcDNA.LD08534); jelly-roll, 1e-68
3lqw_A163 Deoxyuridine 5'-triphosphate nucleotidohydrolase; 1e-68
3so2_A146 Putative uncharacterized protein; deoxyuridine tri 2e-68
3ara_A164 Deoxyuridine 5'-triphosphate nucleotidohydrolase; 6e-68
2ol1_A147 Deoxyuridine 5'-triphosphate nucleotidohydrolase; 5e-67
3f4f_A167 Deoxyuridine 5'-triphosphate nucleotidohydrolase; 3e-66
3p48_A147 Deoxyuridine 5'-triphosphate nucleotidohydrolase; 4e-66
1dun_A134 Deoxyuridine 5'-triphosphate nucleoditohydrolase; 5e-65
1f7d_A136 POL polyprotein; eight stranded beta-barrel, viral 8e-64
3hza_A174 Deoxyuridine 5'-triphosphate nucleotidohydrolase; 7e-58
3tq5_A152 Deoxyuridine 5'-triphosphate nucleotido hydrolase; 2e-54
2xx6_A142 SPBC2 prophage-derived deoxyuridine 5'-triphospha 3e-53
3mdx_A178 Deoxyuridine 5'-triphosphate nucleotidohydrolase; 6e-49
3tqz_A155 Deoxyuridine 5'-triphosphate nucleotidohydrolase; 5e-47
3h6x_A148 Dutpase; jelly-roll beta-barrel, hydrolase; 1.70A 9e-47
1euw_A152 Dutpase, deoxyuridine 5'-triphosphate nucleotidohy 1e-46
2y8c_A173 Deoxyuridine 5'-triphosphate nucleotidohydrolase; 9e-41
2bsy_A278 Deoxyuridine 5'-triphosphate nucleotidohydrolase; 2e-29
2bsy_A 278 Deoxyuridine 5'-triphosphate nucleotidohydrolase; 5e-13
2qxx_A190 DCTP deaminase, deoxycytidine triphosphate deamina 2e-08
3km3_A206 DCTP deaminase, deoxycytidine triphosphate deamina 3e-07
2yzj_A169 167AA long hypothetical dutpase; all beta proteins 3e-07
4dhk_A191 DCTP deaminase, deoxycytidine triphosphate deamina 2e-06
1xs1_A193 DCTP deaminase, deoxycytidine triphosphate deamina 3e-06
1pkh_A204 Bifunctional deaminase/diphosphatase; DCTP deamina 1e-05
2r9q_A370 AGR_C_764P, 2'-deoxycytidine 5'-triphosphate deami 2e-05
>2p9o_A DUTP pyrophosphatase-like protein; dutpase, magnesium binding, hydrolase; 2.00A {Arabidopsis thaliana} PDB: 2pc5_A Length = 169 Back     alignment and structure
 Score =  204 bits (520), Expect = 6e-69
 Identities = 99/114 (86%), Positives = 108/114 (94%)

Query: 16  LRSAAETKVPARGKALVPTDLSIAIPEGTYARIAPRSGLAWKHSMDVGAGVIDADYRGPV 75
           L SA ++KVPARGKAL+PTDLSIA+PEGTYARIAPRSGLAWKHS+DVGAGVIDADYRGPV
Sbjct: 56  LSSAVDSKVPARGKALIPTDLSIAVPEGTYARIAPRSGLAWKHSIDVGAGVIDADYRGPV 115

Query: 76  GVILFNHSDVDFVVKVGDRIAQLIIEKIVTPDVLEVENLDSTVRGEGGFGSTGV 129
           GVILFNHSD DF VK GDRIAQLIIEKIVTPDV+EV++LD TVRG+GGFGSTGV
Sbjct: 116 GVILFNHSDADFEVKFGDRIAQLIIEKIVTPDVVEVDDLDETVRGDGGFGSTGV 169
>3ca9_A Deoxyuridine triphosphatase; dutpase chlorella virus, hydrolase; HET: DUD; 3.00A {Paramecium bursaria chlorella VIRUSIL3A} Length = 165 Back     alignment and structure
>3c2t_A Deoxyuridine triphosphatase; dutpase chlorella virus, hydrolase; HET: DUD; 3.00A {Paramecium bursaria chlorella VIRUSIL3A} PDB: 3c3i_A* Length = 141 Back     alignment and structure
>3ecy_A CG4584-PA, isoform A (bcDNA.LD08534); jelly-roll, dimeric assembly, hydrolase; 1.88A {Drosophila melanogaster} Length = 160 Back     alignment and structure
>3lqw_A Deoxyuridine 5'-triphosphate nucleotidohydrolase; emerald biostructures, ALS collaborative crystallography; 1.30A {Entamoeba histolytica} Length = 163 Back     alignment and structure
>3so2_A Putative uncharacterized protein; deoxyuridine triphosphatase, dutpase, cancer MARK hydrolase; 1.64A {Chlorella variabilis} Length = 146 Back     alignment and structure
>3ara_A Deoxyuridine 5'-triphosphate nucleotidohydrolase; magnesium binding, hydrolase-hydrolase inhibitor; HET: MKH; 1.70A {Homo sapiens} PDB: 2hqu_A* 3arn_A* 3ehw_A* 1q5h_A* 1q5u_X Length = 164 Back     alignment and structure
>2ol1_A Deoxyuridine 5'-triphosphate nucleotidohydrolase; fold, jelly-roll, superfamily, dutpase-like; HET: UMP; 1.80A {Vaccinia virus} PDB: 2oke_A* 2okd_A* 2ol0_A* 2okb_A Length = 147 Back     alignment and structure
>3f4f_A Deoxyuridine 5'-triphosphate nucleotidohydrolase; trimer, beta barrel, UMP, product complex, DUTP pyrophosphat DITP; HET: UMP; 2.00A {Saccharomyces cerevisiae} PDB: 3hhq_A Length = 167 Back     alignment and structure
>3p48_A Deoxyuridine 5'-triphosphate nucleotidohydrolase; trimer, beta barrel, DUMPPNP pyrophosphatase, phosphoprotein, structural genomics; HET: DUP; 1.67A {Saccharomyces cerevisiae} Length = 147 Back     alignment and structure
>1dun_A Deoxyuridine 5'-triphosphate nucleoditohydrolase; dutpase, EIAV, trimeric enzyme, aspartyl protease; 1.90A {Equine infectious anemia virus} SCOP: b.85.4.1 PDB: 1duc_A Length = 134 Back     alignment and structure
>1f7d_A POL polyprotein; eight stranded beta-barrel, viral protein, hydrolase; 1.40A {Feline immunodeficiency virus} SCOP: b.85.4.1 PDB: 1f7k_A* 1f7n_A* 1f7o_A 1f7p_A* 1f7q_A* 1f7r_A* 1dut_A Length = 136 Back     alignment and structure
>3hza_A Deoxyuridine 5'-triphosphate nucleotidohydrolase; jelly roll, domain swapping, nucleotide metabolis; HET: DUP; 1.20A {Mycobacterium tuberculosis} PDB: 3loj_A* 1six_A* 1slh_A* 1sm8_A* 1smc_A* 1snf_A* 2py4_A* 3h6d_A* 3i93_A* 1mq7_A 1sjn_A* Length = 174 Back     alignment and structure
>3tq5_A Deoxyuridine 5'-triphosphate nucleotido hydrolase; jelly roll; HET: UMP; 1.40A {Mason-pfizer monkey virus} PDB: 2d4m_A 2d4l_A* 3tp1_A* 3tpn_A* 3tps_A* 3tpw_A* 3tpy_A* 3tq3_A* 3tq4_A* 2d4n_A* 3trl_A* 3trn_A* 3ts6_A* 3tsl_A* 3tta_A* Length = 152 Back     alignment and structure
>2xx6_A SPBC2 prophage-derived deoxyuridine 5'-triphospha nucleotidohydrolase YOSS; 1.74A {Bacillus subtilis} PDB: 2baz_A 2xy3_A* 2y1t_A* 2xcd_A 2xce_A* Length = 142 Back     alignment and structure
>3mdx_A Deoxyuridine 5'-triphosphate nucleotidohydrolase; metal-binding, nucleotide metabolism, structural genomics; 1.45A {Brucella melitensis} PDB: 3mbq_A Length = 178 Back     alignment and structure
>3tqz_A Deoxyuridine 5'-triphosphate nucleotidohydrolase; purines, pyrimidines, nucleosides, nucleotides; 1.75A {Coxiella burnetii} Length = 155 Back     alignment and structure
>3h6x_A Dutpase; jelly-roll beta-barrel, hydrolase; 1.70A {Streptococcus mutans} Length = 148 Back     alignment and structure
>1euw_A Dutpase, deoxyuridine 5'-triphosphate nucleotidohydrolase; jelly roll, mercury derivative; 1.05A {Escherichia coli} SCOP: b.85.4.1 PDB: 1dud_A 1dup_A 1eu5_A 1rn8_A* 1seh_A* 2hr6_A* 2hrm_A* 1rnj_A* 1syl_A* Length = 152 Back     alignment and structure
>2y8c_A Deoxyuridine 5'-triphosphate nucleotidohydrolase; malaria; HET: DUQ; 2.10A {Plasmodium falciparum} PDB: 1vyq_A* Length = 173 Back     alignment and structure
>2bsy_A Deoxyuridine 5'-triphosphate nucleotidohydrolase; dutpase, monomer, nucleotide metabolism, structural proteomics in europe, spine; HET: UMP; 1.5A {Human herpesvirus 4} SCOP: b.85.4.1 b.85.4.1 PDB: 2bt1_A* 2we1_A* 2we0_A* 2we2_A* 2we3_A* Length = 278 Back     alignment and structure
>2bsy_A Deoxyuridine 5'-triphosphate nucleotidohydrolase; dutpase, monomer, nucleotide metabolism, structural proteomics in europe, spine; HET: UMP; 1.5A {Human herpesvirus 4} SCOP: b.85.4.1 b.85.4.1 PDB: 2bt1_A* 2we1_A* 2we0_A* 2we2_A* 2we3_A* Length = 278 Back     alignment and structure
>2qxx_A DCTP deaminase, deoxycytidine triphosphate deaminase; distorted beta barrel, hydrolase, nucleotide metabolism; HET: TTP 1PE; 2.00A {Mycobacterium tuberculosis} PDB: 2qlp_A* Length = 190 Back     alignment and structure
>3km3_A DCTP deaminase, deoxycytidine triphosphate deaminase; ssgcid, NIH, niaid, SBRI, UW, decode, deoxycytidine triphosp deaminase; 2.10A {Anaplasma phagocytophilum} Length = 206 Back     alignment and structure
>2yzj_A 167AA long hypothetical dutpase; all beta proteins, hypothetical protein, NPPSFA; HET: DUD; 1.66A {Sulfolobus tokodaii} PDB: 2zdc_A Length = 169 Back     alignment and structure
>4dhk_A DCTP deaminase, deoxycytidine triphosphate deaminase; hydrolase; 2.05A {Burkholderia thailandensis} Length = 191 Back     alignment and structure
>1xs1_A DCTP deaminase, deoxycytidine triphosphate deaminase; nucleotide metabolism, trimer, hydrolase; HET: DUT; 1.80A {Escherichia coli} SCOP: b.85.4.1 PDB: 2v9x_A* 1xs6_A* 1xs4_A* 2j4q_A* 2j4h_A* Length = 193 Back     alignment and structure
>1pkh_A Bifunctional deaminase/diphosphatase; DCTP deaminase, dutpase, DCD-DUT, MJ0430, DCTP, DUTP, hydrolase; 1.42A {Methanocaldococcus jannaschii} SCOP: b.85.4.1 PDB: 1ogh_A 1pkj_A* 1pkk_A* 2hxb_A 2hxe_A 3gf0_A 2hxd_A* Length = 204 Back     alignment and structure
>2r9q_A AGR_C_764P, 2'-deoxycytidine 5'-triphosphate deaminase; structural genom MCSG, PSI-2, protein structure initiative; 2.20A {Agrobacterium tumefaciens str} Length = 370 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query129
3ecy_A160 CG4584-PA, isoform A (bcDNA.LD08534); jelly-roll, 100.0
3so2_A146 Putative uncharacterized protein; deoxyuridine tri 100.0
3p48_A147 Deoxyuridine 5'-triphosphate nucleotidohydrolase; 100.0
3f4f_A167 Deoxyuridine 5'-triphosphate nucleotidohydrolase; 100.0
3lqw_A163 Deoxyuridine 5'-triphosphate nucleotidohydrolase; 100.0
3c2t_A141 Deoxyuridine triphosphatase; dutpase chlorella vir 100.0
2ol1_A147 Deoxyuridine 5'-triphosphate nucleotidohydrolase; 100.0
2p9o_A169 DUTP pyrophosphatase-like protein; dutpase, magnes 100.0
3tqz_A155 Deoxyuridine 5'-triphosphate nucleotidohydrolase; 100.0
3ara_A164 Deoxyuridine 5'-triphosphate nucleotidohydrolase; 100.0
3hza_A174 Deoxyuridine 5'-triphosphate nucleotidohydrolase; 100.0
3ca9_A165 Deoxyuridine triphosphatase; dutpase chlorella vir 100.0
3mdx_A178 Deoxyuridine 5'-triphosphate nucleotidohydrolase; 100.0
1euw_A152 Dutpase, deoxyuridine 5'-triphosphate nucleotidohy 100.0
1f7d_A136 POL polyprotein; eight stranded beta-barrel, viral 100.0
3t64_A181 Deoxyuridine 5'-triphosphate nucleotidohydrolase,; 100.0
1dun_A134 Deoxyuridine 5'-triphosphate nucleoditohydrolase; 100.0
2xx6_A142 SPBC2 prophage-derived deoxyuridine 5'-triphospha 100.0
3h6x_A148 Dutpase; jelly-roll beta-barrel, hydrolase; 1.70A 100.0
3tq5_A152 Deoxyuridine 5'-triphosphate nucleotido hydrolase; 100.0
2bsy_A278 Deoxyuridine 5'-triphosphate nucleotidohydrolase; 100.0
2qxx_A190 DCTP deaminase, deoxycytidine triphosphate deamina 99.94
1xs1_A193 DCTP deaminase, deoxycytidine triphosphate deamina 99.94
3km3_A206 DCTP deaminase, deoxycytidine triphosphate deamina 99.94
2bsy_A 278 Deoxyuridine 5'-triphosphate nucleotidohydrolase; 99.94
4dhk_A191 DCTP deaminase, deoxycytidine triphosphate deamina 99.93
2yzj_A169 167AA long hypothetical dutpase; all beta proteins 99.92
1pkh_A204 Bifunctional deaminase/diphosphatase; DCTP deamina 99.91
2r9q_A 370 AGR_C_764P, 2'-deoxycytidine 5'-triphosphate deami 99.87
2r9q_A370 AGR_C_764P, 2'-deoxycytidine 5'-triphosphate deami 99.82
>3ecy_A CG4584-PA, isoform A (bcDNA.LD08534); jelly-roll, dimeric assembly, hydrolase; 1.88A {Drosophila melanogaster} Back     alignment and structure
Probab=100.00  E-value=1e-48  Score=283.82  Aligned_cols=124  Identities=60%  Similarity=0.933  Sum_probs=100.3

Q ss_pred             EeccCCeEEEEEcCccEEEcCCCEEEEEcCcEEEeCCCcEEEEEeCCCcccccceeecceEEcCCCccceEEEEEcCCCC
Q 032989            6 FFTIICYHCILRSAAETKVPARGKALVPTDLSIAIPEGTYARIAPRSGLAWKHSMDVGAGVIDADYRGPVGVILFNHSDV   85 (129)
Q Consensus         6 ~~t~~~aG~DL~~~~~~~i~p~~~~li~Tg~~v~ip~g~~~~i~~RSsl~~k~gl~v~~gvID~gY~Gei~i~l~N~~~~   85 (129)
                      .+|.+||||||+++++++|+|+++++|+||+++++|+||++++++|||+++|+||.+.+|+||+||+|||++.|+|++++
T Consensus        36 ~~t~~sAG~DL~a~~~~~I~Pge~~lV~TGi~i~iP~g~~~~i~pRSsla~k~Gi~v~~GvID~dYrGei~v~l~N~~~~  115 (160)
T 3ecy_A           36 RGSAKAAGVDLRSAYDVVVPARGKAIVKTDLQVQVPEGSYGRVAPRSGLAVKNFIDVGAGVVDEDYRGNLGVVLFNHSDV  115 (160)
T ss_dssp             BCSTTCSSEEEECSSCEEECTTCEEEEECCEEEECCTTCEEEEECC-------CEEEECEEECTTCCSCCEEEEEECSSS
T ss_pred             ccCCCceeEeEecCCCEEEcCCCEEEEECCcEEEcCCCeEEEEEecccccccCCEEEeccCcCCCccCcEEEEEEeCCCC
Confidence            57899999999999999999999999999999999999999999999999889999999999999999999999999999


Q ss_pred             cEEeeCCCEEEEEEEeecccccEEEeccCCCccCCCCCCcccCC
Q 032989           86 DFVVKVGDRIAQLIIEKIVTPDVLEVENLDSTVRGEGGFGSTGV  129 (129)
Q Consensus        86 ~~~i~~G~riaQlv~~~~~~~~~~~v~~l~~t~Rg~~gfGSTG~  129 (129)
                      ++.|++|+|||||+|.++..+.|++|++|++|+||+|||||||+
T Consensus       116 ~~~I~~GdRIAQlV~~~v~~~~~~~v~~l~~t~RG~gGFGSTG~  159 (160)
T 3ecy_A          116 DFEVKHGDRIAQFICERIFYPQLVMVDKLEDTERGEAGFGSTGV  159 (160)
T ss_dssp             CEEECTTCEEEEEEEEEEECCEEEEESCC---------------
T ss_pred             ceEECCCCEEEEEEEeecceeeEEEeCccCCCccCCCCCCCCCc
Confidence            99999999999999999999999999999999999999999995
>3so2_A Putative uncharacterized protein; deoxyuridine triphosphatase, dutpase, cancer MARK hydrolase; 1.64A {Chlorella variabilis} Back     alignment and structure
>3p48_A Deoxyuridine 5'-triphosphate nucleotidohydrolase; trimer, beta barrel, DUMPPNP pyrophosphatase, phosphoprotein, structural genomics; HET: DUP; 1.67A {Saccharomyces cerevisiae} SCOP: b.85.4.0 Back     alignment and structure
>3f4f_A Deoxyuridine 5'-triphosphate nucleotidohydrolase; trimer, beta barrel, UMP, product complex, DUTP pyrophosphat DITP; HET: UMP; 2.00A {Saccharomyces cerevisiae} PDB: 3hhq_A Back     alignment and structure
>3lqw_A Deoxyuridine 5'-triphosphate nucleotidohydrolase; emerald biostructures, ALS collaborative crystallography; 1.30A {Entamoeba histolytica} Back     alignment and structure
>3c2t_A Deoxyuridine triphosphatase; dutpase chlorella virus, hydrolase; HET: DUD; 3.00A {Paramecium bursaria chlorella VIRUSIL3A} PDB: 3c3i_A* Back     alignment and structure
>2ol1_A Deoxyuridine 5'-triphosphate nucleotidohydrolase; fold, jelly-roll, superfamily, dutpase-like; HET: UMP; 1.80A {Vaccinia virus} PDB: 2oke_A* 2okd_A* 2ol0_A* 2okb_A Back     alignment and structure
>2p9o_A DUTP pyrophosphatase-like protein; dutpase, magnesium binding, hydrolase; 2.00A {Arabidopsis thaliana} PDB: 2pc5_A Back     alignment and structure
>3tqz_A Deoxyuridine 5'-triphosphate nucleotidohydrolase; purines, pyrimidines, nucleosides, nucleotides; 1.75A {Coxiella burnetii} Back     alignment and structure
>3ara_A Deoxyuridine 5'-triphosphate nucleotidohydrolase; magnesium binding, hydrolase-hydrolase inhibitor; HET: MKH; 1.70A {Homo sapiens} PDB: 2hqu_A* 3arn_A* 3ehw_A* 1q5h_A* 1q5u_X Back     alignment and structure
>3hza_A Deoxyuridine 5'-triphosphate nucleotidohydrolase; jelly roll, domain swapping, nucleotide metabolis; HET: DUP; 1.20A {Mycobacterium tuberculosis} SCOP: b.85.4.1 PDB: 3loj_A* 1six_A* 1slh_A* 1sm8_A* 1smc_A* 1snf_A* 2py4_A* 3h6d_A* 3i93_A* 1mq7_A 1sjn_A* 4gk6_A Back     alignment and structure
>3ca9_A Deoxyuridine triphosphatase; dutpase chlorella virus, hydrolase; HET: DUD; 3.00A {Paramecium bursaria chlorella VIRUSIL3A} Back     alignment and structure
>3mdx_A Deoxyuridine 5'-triphosphate nucleotidohydrolase; metal-binding, nucleotide metabolism, structural genomics; 1.45A {Brucella melitensis} PDB: 3mbq_A Back     alignment and structure
>1euw_A Dutpase, deoxyuridine 5'-triphosphate nucleotidohydrolase; jelly roll, mercury derivative; 1.05A {Escherichia coli} SCOP: b.85.4.1 PDB: 1dud_A 1dup_A 1eu5_A 1rn8_A* 1seh_A* 2hr6_A* 2hrm_A* 1rnj_A* 1syl_A* Back     alignment and structure
>1f7d_A POL polyprotein; eight stranded beta-barrel, viral protein, hydrolase; 1.40A {Feline immunodeficiency virus} SCOP: b.85.4.1 PDB: 1f7k_A* 1f7n_A* 1f7o_A 1f7p_A* 1f7q_A* 1f7r_A* 1dut_A Back     alignment and structure
>3t64_A Deoxyuridine 5'-triphosphate nucleotidohydrolase,; hydrolase, DUTP binding, nucleus, hydrolase-hydrolase inhibi complex; HET: DU3; 1.65A {Plasmodium falciparum 3D7} PDB: 3t6y_A* 3t70_A* 3t60_A* 2y8c_A* 1vyq_A* Back     alignment and structure
>1dun_A Deoxyuridine 5'-triphosphate nucleoditohydrolase; dutpase, EIAV, trimeric enzyme, aspartyl protease; 1.90A {Equine infectious anemia virus} SCOP: b.85.4.1 PDB: 1duc_A Back     alignment and structure
>2xx6_A SPBC2 prophage-derived deoxyuridine 5'-triphospha nucleotidohydrolase YOSS; 1.74A {Bacillus subtilis} PDB: 2baz_A 2xy3_A* 2y1t_A* 2xcd_A 2xce_A* Back     alignment and structure
>3h6x_A Dutpase; jelly-roll beta-barrel, hydrolase; 1.70A {Streptococcus mutans} Back     alignment and structure
>3tq5_A Deoxyuridine 5'-triphosphate nucleotido hydrolase; jelly roll; HET: UMP; 1.40A {Mason-pfizer monkey virus} PDB: 2d4m_A 2d4l_A* 3tp1_A* 3tpn_A* 3tps_A* 3tpw_A* 3tpy_A* 3tq3_A* 3tq4_A* 2d4n_A* 3trl_A* 3trn_A* 3ts6_A* 3tsl_A* 3tta_A* Back     alignment and structure
>2bsy_A Deoxyuridine 5'-triphosphate nucleotidohydrolase; dutpase, monomer, nucleotide metabolism, structural proteomics in europe, spine; HET: UMP; 1.5A {Human herpesvirus 4} SCOP: b.85.4.1 b.85.4.1 PDB: 2bt1_A* 2we1_A* 2we0_A* 2we2_A* 2we3_A* Back     alignment and structure
>2qxx_A DCTP deaminase, deoxycytidine triphosphate deaminase; distorted beta barrel, hydrolase, nucleotide metabolism; HET: TTP 1PE; 2.00A {Mycobacterium tuberculosis} PDB: 2qlp_A* Back     alignment and structure
>1xs1_A DCTP deaminase, deoxycytidine triphosphate deaminase; nucleotide metabolism, trimer, hydrolase; HET: DUT; 1.80A {Escherichia coli} SCOP: b.85.4.1 PDB: 2v9x_A* 1xs6_A* 1xs4_A* 2j4q_A* 2j4h_A* Back     alignment and structure
>3km3_A DCTP deaminase, deoxycytidine triphosphate deaminase; ssgcid, NIH, niaid, SBRI, UW, decode, deoxycytidine triphosp deaminase; 2.10A {Anaplasma phagocytophilum} Back     alignment and structure
>2bsy_A Deoxyuridine 5'-triphosphate nucleotidohydrolase; dutpase, monomer, nucleotide metabolism, structural proteomics in europe, spine; HET: UMP; 1.5A {Human herpesvirus 4} SCOP: b.85.4.1 b.85.4.1 PDB: 2bt1_A* 2we1_A* 2we0_A* 2we2_A* 2we3_A* Back     alignment and structure
>4dhk_A DCTP deaminase, deoxycytidine triphosphate deaminase; hydrolase; 2.05A {Burkholderia thailandensis} Back     alignment and structure
>2yzj_A 167AA long hypothetical dutpase; all beta proteins, hypothetical protein, NPPSFA; HET: DUD; 1.66A {Sulfolobus tokodaii} PDB: 2zdc_A Back     alignment and structure
>1pkh_A Bifunctional deaminase/diphosphatase; DCTP deaminase, dutpase, DCD-DUT, MJ0430, DCTP, DUTP, hydrolase; 1.42A {Methanocaldococcus jannaschii} SCOP: b.85.4.1 PDB: 1ogh_A 1pkj_A* 1pkk_A* 2hxb_A 2hxe_A 3gf0_A 2hxd_A* Back     alignment and structure
>2r9q_A AGR_C_764P, 2'-deoxycytidine 5'-triphosphate deaminase; structural genom MCSG, PSI-2, protein structure initiative; 2.20A {Agrobacterium tumefaciens str} Back     alignment and structure
>2r9q_A AGR_C_764P, 2'-deoxycytidine 5'-triphosphate deaminase; structural genom MCSG, PSI-2, protein structure initiative; 2.20A {Agrobacterium tumefaciens str} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 129
d1f7da_118 b.85.4.1 (A:) Deoxyuridine 5'-triphosphate nucleot 9e-26
d3ehwa1136 b.85.4.1 (A:24-159) Deoxyuridine 5'-triphosphate n 1e-25
d2bsya1113 b.85.4.1 (A:4-116) Monomeric viral dUTPase {Epstei 2e-25
d1vyqa1159 b.85.4.1 (A:1-159) Deoxyuridine 5'-triphosphate nu 2e-25
d1sixa_153 b.85.4.1 (A:) Deoxyuridine 5'-triphosphate nucleot 6e-25
d2bsya2136 b.85.4.1 (A:121-256) Monomeric viral dUTPase {Epst 3e-23
d1duna_120 b.85.4.1 (A:) Deoxyuridine 5'-triphosphate nucleot 1e-22
d1euwa_136 b.85.4.1 (A:) Deoxyuridine 5'-triphosphate nucleot 1e-21
d1pkha_182 b.85.4.1 (A:) Bifunctional dCTP deaminase/dUTPase 2e-12
d1xs1a_193 b.85.4.1 (A:) Deoxycytidine triphosphate deaminase 3e-11
>d1f7da_ b.85.4.1 (A:) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Feline immunodeficiency virus [TaxId: 11673]} Length = 118 Back     information, alignment and structure

class: All beta proteins
fold: beta-clip
superfamily: dUTPase-like
family: dUTPase-like
domain: Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase)
species: Feline immunodeficiency virus [TaxId: 11673]

 Score = 91.5 bits (227), Expect = 9e-26
 Identities = 29/99 (29%), Positives = 49/99 (49%), Gaps = 1/99 (1%)

Query: 16  LRSAAETKVPARGKALVPTDLSIAIPEGTYARIAPRSGLAWKHSMDVGAGVIDADYRGPV 75
           L +A E  +      ++PT + + +P+G +  I  +S +     +DV  GVID  YRG +
Sbjct: 20  LLAAKEIHLLPGEVKVIPTGVKLMLPKGYWGLIIGKSSI-GSKGLDVLGGVIDEGYRGEI 78

Query: 76  GVILFNHSDVDFVVKVGDRIAQLIIEKIVTPDVLEVENL 114
           GVI+ N S     +    +IAQLII       + + + +
Sbjct: 79  GVIMINVSRKSITLMERQKIAQLIILPCKHEVLEQGKVV 117
>d3ehwa1 b.85.4.1 (A:24-159) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Human (Homo sapiens) [TaxId: 9606]} Length = 136 Back     information, alignment and structure
>d2bsya1 b.85.4.1 (A:4-116) Monomeric viral dUTPase {Epstein-barr virus [TaxId: 10376]} Length = 113 Back     information, alignment and structure
>d1vyqa1 b.85.4.1 (A:1-159) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Plasmodium falciparum [TaxId: 5833]} Length = 159 Back     information, alignment and structure
>d1sixa_ b.85.4.1 (A:) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Mycobacterium tuberculosis, rv2697c [TaxId: 1773]} Length = 153 Back     information, alignment and structure
>d2bsya2 b.85.4.1 (A:121-256) Monomeric viral dUTPase {Epstein-barr virus [TaxId: 10376]} Length = 136 Back     information, alignment and structure
>d1duna_ b.85.4.1 (A:) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Equine infectious anemia virus [TaxId: 11665]} Length = 120 Back     information, alignment and structure
>d1euwa_ b.85.4.1 (A:) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Escherichia coli [TaxId: 562]} Length = 136 Back     information, alignment and structure
>d1pkha_ b.85.4.1 (A:) Bifunctional dCTP deaminase/dUTPase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 182 Back     information, alignment and structure
>d1xs1a_ b.85.4.1 (A:) Deoxycytidine triphosphate deaminase (dCTP deaminase) {Escherichia coli [TaxId: 562]} Length = 193 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query129
d3ehwa1136 Deoxyuridine 5'-triphosphate nucleotidohydrolase ( 100.0
d1sixa_153 Deoxyuridine 5'-triphosphate nucleotidohydrolase ( 100.0
d1f7da_118 Deoxyuridine 5'-triphosphate nucleotidohydrolase ( 100.0
d1duna_120 Deoxyuridine 5'-triphosphate nucleotidohydrolase ( 100.0
d1euwa_136 Deoxyuridine 5'-triphosphate nucleotidohydrolase ( 100.0
d1vyqa1159 Deoxyuridine 5'-triphosphate nucleotidohydrolase ( 100.0
d2bsya1113 Monomeric viral dUTPase {Epstein-barr virus [TaxId 99.97
d2bsya2136 Monomeric viral dUTPase {Epstein-barr virus [TaxId 99.97
d1xs1a_193 Deoxycytidine triphosphate deaminase (dCTP deamina 99.88
d1pkha_182 Bifunctional dCTP deaminase/dUTPase {Archaeon Meth 99.84
d1sdwa2158 Peptidylglycine alpha-hydroxylating monooxygenase, 83.32
>d3ehwa1 b.85.4.1 (A:24-159) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: beta-clip
superfamily: dUTPase-like
family: dUTPase-like
domain: Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase)
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=4.6e-44  Score=251.75  Aligned_cols=120  Identities=56%  Similarity=0.828  Sum_probs=117.4

Q ss_pred             EeccCCeEEEEEcCccEEEcCCCEEEEEcCcEEEeCCCcEEEEEeCCCcccccceeecceEEcCCCccceEEEEEcCCCC
Q 032989            6 FFTIICYHCILRSAAETKVPARGKALVPTDLSIAIPEGTYARIAPRSGLAWKHSMDVGAGVIDADYRGPVGVILFNHSDV   85 (129)
Q Consensus         6 ~~t~~~aG~DL~~~~~~~i~p~~~~li~Tg~~v~ip~g~~~~i~~RSsl~~k~gl~v~~gvID~gY~Gei~i~l~N~~~~   85 (129)
                      ..|+.||||||+++++++|+|+++++|+||+++++|+||++++++|||++.|++|.+..|+||+||||||++.++|++++
T Consensus        17 r~t~~~AG~DL~~~ed~~i~p~~~~~i~tgi~~~ip~g~~~~i~~RSs~~~k~~l~~~~GvID~dYrGei~v~l~N~~~~   96 (136)
T d3ehwa1          17 RGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKE   96 (136)
T ss_dssp             ESSTTCSEEEEECSSCEEECTTEEEEEECCEEEECCTTEEEEEECCHHHHHHHCEEEECCEECTTBCSCCEEEEEECSSS
T ss_pred             cCCCCCceEEEecCeeEEEEccceEEEECCcEEeecCCcEEEEeeeccccccceEEeCCEEEcCCCCceEEEEEEecccc
Confidence            57899999999999999999999999999999999999999999999999888999999999999999999999999999


Q ss_pred             cEEeeCCCEEEEEEEeecccccEEEeccCCCccCCCCCCc
Q 032989           86 DFVVKVGDRIAQLIIEKIVTPDVLEVENLDSTVRGEGGFG  125 (129)
Q Consensus        86 ~~~i~~G~riaQlv~~~~~~~~~~~v~~l~~t~Rg~~gfG  125 (129)
                      ++.|++|+|||||++.++..+++++|++|++|+||+||||
T Consensus        97 ~~~i~~G~riaQlv~~~~~~~~~~~v~~l~~t~RG~gGFG  136 (136)
T d3ehwa1          97 KFEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFG  136 (136)
T ss_dssp             CEEECTTCEEEEEEEEEBCCCCEEECSCCCCCSSBTCCTT
T ss_pred             ceEEecCCeEEEEEEccCCceEEEEecccCCCccCCCCCC
Confidence            9999999999999999999999999999999999999998
>d1sixa_ b.85.4.1 (A:) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Mycobacterium tuberculosis, rv2697c [TaxId: 1773]} Back     information, alignment and structure
>d1f7da_ b.85.4.1 (A:) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Feline immunodeficiency virus [TaxId: 11673]} Back     information, alignment and structure
>d1duna_ b.85.4.1 (A:) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Equine infectious anemia virus [TaxId: 11665]} Back     information, alignment and structure
>d1euwa_ b.85.4.1 (A:) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vyqa1 b.85.4.1 (A:1-159) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2bsya1 b.85.4.1 (A:4-116) Monomeric viral dUTPase {Epstein-barr virus [TaxId: 10376]} Back     information, alignment and structure
>d2bsya2 b.85.4.1 (A:121-256) Monomeric viral dUTPase {Epstein-barr virus [TaxId: 10376]} Back     information, alignment and structure
>d1xs1a_ b.85.4.1 (A:) Deoxycytidine triphosphate deaminase (dCTP deaminase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pkha_ b.85.4.1 (A:) Bifunctional dCTP deaminase/dUTPase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1sdwa2 b.121.1.2 (A:199-356) Peptidylglycine alpha-hydroxylating monooxygenase, PHM {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure