Citrus Sinensis ID: 033022


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------13
MDGLPSGYRPNVGVCLINSDSQIFVASRLNVPGAWQMPQGGIEDGEDPKLAAMRELREETGIVSAEIIAEVPNWLTYDFPPAVKTKVNRLWGGEWHGQAQKWYASLLLLVPLTLSTHTHFMKENQVVLS
ccccccccccccEEEEEcccccEEEEEEcccccccccccccccccccHHHHHHHHHHHHHcccEEEEEEEcccCEECccccccHHccccccccCCccccccEEEEEccccccccccccccccccccccc
***LPSGYRPNVGVCLINSDSQIFVASRLNVPGAWQMPQGGIEDGEDPKLAAMRELREETGIVSAEIIAEVPNWLTYDFPPAVKTKVNRLWGGEWHGQAQKWYASLLLLVPLTLSTHTHFMKENQVVLS
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDGLPSGYRPNVGVCLINSDSQIFVASRLNVPGAWQMPQGGIEDGEDPKLAAMRELREETGIVSAEIIAEVPNWLTYDFPPAVKTKVNRLWGGEWHGQAQKWYASLLLLVPLTLSTHTHFMKENQVVLS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
RNA pyrophosphohydrolase Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.probableQ3IZC1
RNA pyrophosphohydrolase Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.probableB9KN59
RNA pyrophosphohydrolase Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.probableA1B502

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.6.-.-Acting on acid anhydrides.probable
3.6.1.-In phosphorous-containing anhydrides.probable
3.6.1.17Bis(5'-nucleosyl)-tetraphosphatase (asymmetrical).probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1F3Y, chain A
Confidence level:very confident
Coverage over the Query: 1-80
View the alignment between query and template
View the model in PyMOL
Template: 3R03, chain A
Confidence level:very confident
Coverage over the Query: 8-119
View the alignment between query and template
View the model in PyMOL