Citrus Sinensis ID: 033022


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------13
MDGLPSGYRPNVGVCLINSDSQIFVASRLNVPGAWQMPQGGIEDGEDPKLAAMRELREETGIVSAEIIAEVPNWLTYDFPPAVKTKVNRLWGGEWHGQAQKWYASLLLLVPLTLSTHTHFMKENQVVLS
ccccccccccccEEEEEcccccEEEEEEcccccccccccccccccccHHHHHHHHHHHHHcccEEEEEEEcccEEEEccccccHHccccccccEEccccccEEEEEccccccccccccccccccccccc
cccccccccccEEEEEEcccccEEEEEEcccccccccccccccccccHHHHHHHHHHHHHcEccEEEEEEccccEEccccHHHHHHHHHHccccccccHEEEEEEEEcccccHcccccccHcccEEEEc
mdglpsgyrpnvgvclinsdsqIFVASrlnvpgawqmpqggiedgedpKLAAMRELREETGIVSAEIIAEvpnwltydfppavktkvnrlwggewhgQAQKWYASLLLLVPLTLSTHTHFMKENQVVLS
mdglpsgyRPNVGVCLINSDSQIFVASRLNVPGAWQMPQGGIEDGEDPKLAAMRELREETGIVSAEIIAEvpnwltydfpPAVKTKVNRLWGGEWHGQAQKWYASLLLLVPLTLSTHTHFMKENQVVLS
MDGLPSGYRPNVGVCLINSDSQIFVASRLNVPGAWQMPQGGIEDGEDPKLAAMRELREETGIVSAEIIAEVPNWLTYDFPPAVKTKVNRLWGGEWHGQAQKWYAsllllvpltlsththFMKENQVVLS
*********PNVGVCLINSDSQIFVASRLNVPGAWQM********************EETGIVSAEIIAEVPNWLTYDFPPAVKTKVNRLWGGEWHGQAQKWYASLLLLVPLTLSTHTHFM********
***LPSGYRPNVGVCLINSDSQIFVASRLNVPGAWQMPQGGIEDGEDPKLAAMRELREETGIVSAEIIAEVPNWLTYDFPPAVKTKVNRLWGGEWHGQAQKWYASLLLLVPLTLSTHTHFMKENQVVLS
MDGLPSGYRPNVGVCLINSDSQIFVASRLNVPGAWQMPQGGIEDGEDPKLAAMRELREETGIVSAEIIAEVPNWLTYDFPPAVKTKVNRLWGGEWHGQAQKWYASLLLLVPLTLSTHTHFMKENQVVLS
****PSGYRPNVGVCLINSDSQIFVASRLNVPGAWQMPQGGIEDGEDPKLAAMRELREETGIVSAEIIAEVPNWLTYDFPPAVKTKVNRLWGGEWHGQAQKWYASLLLLVPLTLSTHTHFMKENQVVLS
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDGLPSGYRPNVGVCLINSDSQIFVASRLNVPGAWQMPQGGIEDGEDPKLAAMRELREETGIVSAEIIAEVPNWLTYDFPPAVKTKVNRLWGGEWHGQAQKWYASLLLLVPLTLSTHTHFMKENQVVLS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query129 2.2.26 [Sep-21-2011]
Q9C6Z2175 Nudix hydrolase 25 OS=Ara yes no 0.798 0.588 0.883 2e-51
Q9CAF2216 Nudix hydrolase 26, chlor no no 0.798 0.476 0.650 1e-38
Q9FNH4227 Nudix hydrolase 27, chlor no no 0.767 0.436 0.616 6e-34
Q2RV14165 RNA pyrophosphohydrolase yes no 0.751 0.587 0.539 2e-24
B9KN59162 RNA pyrophosphohydrolase yes no 0.775 0.617 0.509 1e-23
Q3IZC1162 RNA pyrophosphohydrolase yes no 0.775 0.617 0.509 1e-23
A3PMX6162 RNA pyrophosphohydrolase yes no 0.720 0.574 0.525 3e-23
A1B502163 RNA pyrophosphohydrolase yes no 0.782 0.619 0.513 1e-22
A4WWV6162 RNA pyrophosphohydrolase yes no 0.720 0.574 0.515 2e-22
Q5FU29170 RNA pyrophosphohydrolase yes no 0.720 0.547 0.484 3e-22
>sp|Q9C6Z2|NUD25_ARATH Nudix hydrolase 25 OS=Arabidopsis thaliana GN=NUDT25 PE=1 SV=1 Back     alignment and function desciption
 Score =  200 bits (509), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 91/103 (88%), Positives = 98/103 (95%)

Query: 1   MDGLPSGYRPNVGVCLINSDSQIFVASRLNVPGAWQMPQGGIEDGEDPKLAAMRELREET 60
           M+ LP GYRPNVGVCLINSD+ +FVASRLNVPGAWQMPQGGIEDGEDPK AAMREL+EET
Sbjct: 1   MENLPPGYRPNVGVCLINSDNLVFVASRLNVPGAWQMPQGGIEDGEDPKSAAMRELQEET 60

Query: 61  GIVSAEIIAEVPNWLTYDFPPAVKTKVNRLWGGEWHGQAQKWY 103
           G+VSAEI++EVPNWLTYDFPPAVK KVNRLWGGEWHGQAQKWY
Sbjct: 61  GVVSAEIVSEVPNWLTYDFPPAVKAKVNRLWGGEWHGQAQKWY 103




Mediates the hydrolysis of diadenosine 5',5''-P(1)P(4) tetraphosphate (Ap(4)A), a signaling molecule involved in regulation of DNA replication and repair.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 6EC: .EC: 1EC: .EC: 1EC: 7
>sp|Q9CAF2|NUD26_ARATH Nudix hydrolase 26, chloroplastic OS=Arabidopsis thaliana GN=NUDT26 PE=1 SV=1 Back     alignment and function description
>sp|Q9FNH4|NUD27_ARATH Nudix hydrolase 27, chloroplastic OS=Arabidopsis thaliana GN=NUDT27 PE=1 SV=1 Back     alignment and function description
>sp|Q2RV14|RPPH_RHORT RNA pyrophosphohydrolase OS=Rhodospirillum rubrum (strain ATCC 11170 / NCIB 8255) GN=rppH PE=3 SV=1 Back     alignment and function description
>sp|B9KN59|RPPH_RHOSK RNA pyrophosphohydrolase OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=rppH PE=3 SV=1 Back     alignment and function description
>sp|Q3IZC1|RPPH_RHOS4 RNA pyrophosphohydrolase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=rppH PE=3 SV=1 Back     alignment and function description
>sp|A3PMX6|RPPH_RHOS1 RNA pyrophosphohydrolase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=rppH PE=3 SV=1 Back     alignment and function description
>sp|A1B502|RPPH_PARDP RNA pyrophosphohydrolase OS=Paracoccus denitrificans (strain Pd 1222) GN=rppH PE=3 SV=1 Back     alignment and function description
>sp|A4WWV6|RPPH_RHOS5 RNA pyrophosphohydrolase OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=rppH PE=3 SV=1 Back     alignment and function description
>sp|Q5FU29|RPPH_GLUOX RNA pyrophosphohydrolase OS=Gluconobacter oxydans (strain 621H) GN=rppH PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query129
359472870173 PREDICTED: nudix hydrolase 25-like [Viti 0.798 0.595 0.922 4e-51
449467617173 PREDICTED: nudix hydrolase 25-like [Cucu 0.798 0.595 0.902 5e-51
255570126173 (Di)nucleoside polyphosphate hydrolase, 0.798 0.595 0.902 2e-50
388520493173 unknown [Lotus japonicus] 0.798 0.595 0.912 3e-50
224101843173 predicted protein [Populus trichocarpa] 0.798 0.595 0.912 5e-50
224108323173 predicted protein [Populus trichocarpa] 0.798 0.595 0.902 1e-49
356530740173 PREDICTED: nudix hydrolase 25-like [Glyc 0.798 0.595 0.902 1e-49
15220667175 nudix hydrolase 25 [Arabidopsis thaliana 0.798 0.588 0.883 1e-49
351725143173 uncharacterized protein LOC100306071 [Gl 0.798 0.595 0.902 2e-49
297845940175 hypothetical protein ARALYDRAFT_473229 [ 0.798 0.588 0.873 4e-49
>gi|359472870|ref|XP_002284395.2| PREDICTED: nudix hydrolase 25-like [Vitis vinifera] gi|147845365|emb|CAN79048.1| hypothetical protein VITISV_004867 [Vitis vinifera] gi|297737699|emb|CBI26900.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  205 bits (522), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 95/103 (92%), Positives = 99/103 (96%)

Query: 1   MDGLPSGYRPNVGVCLINSDSQIFVASRLNVPGAWQMPQGGIEDGEDPKLAAMRELREET 60
           M+GLPSGYRPNVGVCLINSD Q+FVASRLNVPGAWQMPQGGIEDGE+PK AAMRELREET
Sbjct: 1   MEGLPSGYRPNVGVCLINSDDQVFVASRLNVPGAWQMPQGGIEDGEEPKSAAMRELREET 60

Query: 61  GIVSAEIIAEVPNWLTYDFPPAVKTKVNRLWGGEWHGQAQKWY 103
           GIVSAEIIAEVPNWLTYDFPPAVK KVNRLW GEWHGQAQKW+
Sbjct: 61  GIVSAEIIAEVPNWLTYDFPPAVKAKVNRLWRGEWHGQAQKWF 103




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|449467617|ref|XP_004151519.1| PREDICTED: nudix hydrolase 25-like [Cucumis sativus] gi|449494621|ref|XP_004159600.1| PREDICTED: nudix hydrolase 25-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|255570126|ref|XP_002526025.1| (Di)nucleoside polyphosphate hydrolase, putative [Ricinus communis] gi|223534672|gb|EEF36365.1| (Di)nucleoside polyphosphate hydrolase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|388520493|gb|AFK48308.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|224101843|ref|XP_002312442.1| predicted protein [Populus trichocarpa] gi|222852262|gb|EEE89809.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224108323|ref|XP_002314805.1| predicted protein [Populus trichocarpa] gi|222863845|gb|EEF00976.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356530740|ref|XP_003533938.1| PREDICTED: nudix hydrolase 25-like [Glycine max] Back     alignment and taxonomy information
>gi|15220667|ref|NP_174303.1| nudix hydrolase 25 [Arabidopsis thaliana] gi|334182949|ref|NP_001185114.1| nudix hydrolase 25 [Arabidopsis thaliana] gi|75308841|sp|Q9C6Z2.1|NUD25_ARATH RecName: Full=Nudix hydrolase 25; Short=AtNUDT25; AltName: Full=Bis(5'-nucleosyl)-tetraphosphatase (asymmetrical) gi|12321626|gb|AAG50852.1|AC074176_1 diadenosine 5,5-P1,P4-tetraphosphate hydrolase, putative [Arabidopsis thaliana] gi|21593042|gb|AAM64991.1| diadenosine 5,5-P1,P4-tetraphosphate hydrolase, putative [Arabidopsis thaliana] gi|98960929|gb|ABF58948.1| At1g30110 [Arabidopsis thaliana] gi|332193058|gb|AEE31179.1| nudix hydrolase 25 [Arabidopsis thaliana] gi|332193059|gb|AEE31180.1| nudix hydrolase 25 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|351725143|ref|NP_001237082.1| uncharacterized protein LOC100306071 [Glycine max] gi|255627447|gb|ACU14068.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|297845940|ref|XP_002890851.1| hypothetical protein ARALYDRAFT_473229 [Arabidopsis lyrata subsp. lyrata] gi|297336693|gb|EFH67110.1| hypothetical protein ARALYDRAFT_473229 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query129
TAIR|locus:2202487175 NUDX25 "AT1G30110" [Arabidopsi 0.798 0.588 0.883 1.2e-49
TAIR|locus:2075840216 NUDX26 "AT3G10620" [Arabidopsi 0.798 0.476 0.650 3.9e-37
TAIR|locus:2164220227 NUDX27 "AT5G06340" [Arabidopsi 0.767 0.436 0.616 2.9e-32
TIGR_CMR|SPO_3585161 SPO_3585 "hydrolase, NUDIX fam 0.720 0.577 0.505 1.5e-21
TIGR_CMR|CJE_0684156 CJE_0684 "(di)nucleoside polyp 0.705 0.583 0.44 3.2e-17
UNIPROTKB|Q9KU53172 rppH "RNA pyrophosphohydrolase 0.736 0.552 0.420 8.8e-15
TIGR_CMR|VC_0671172 VC_0671 "MutT/nudix family pro 0.736 0.552 0.420 8.8e-15
UNIPROTKB|P0A776176 rppH [Escherichia coli K-12 (t 0.705 0.517 0.415 5.6e-13
UNIPROTKB|Q47Y27171 rppH "RNA pyrophosphohydrolase 0.720 0.543 0.383 1.2e-12
TIGR_CMR|CPS_3625171 CPS_3625 "(di)nucleoside polyp 0.720 0.543 0.383 1.2e-12
TAIR|locus:2202487 NUDX25 "AT1G30110" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 517 (187.1 bits), Expect = 1.2e-49, P = 1.2e-49
 Identities = 91/103 (88%), Positives = 98/103 (95%)

Query:     1 MDGLPSGYRPNVGVCLINSDSQIFVASRLNVPGAWQMPQGGIEDGEDPKLAAMRELREET 60
             M+ LP GYRPNVGVCLINSD+ +FVASRLNVPGAWQMPQGGIEDGEDPK AAMREL+EET
Sbjct:     1 MENLPPGYRPNVGVCLINSDNLVFVASRLNVPGAWQMPQGGIEDGEDPKSAAMRELQEET 60

Query:    61 GIVSAEIIAEVPNWLTYDFPPAVKTKVNRLWGGEWHGQAQKWY 103
             G+VSAEI++EVPNWLTYDFPPAVK KVNRLWGGEWHGQAQKWY
Sbjct:    61 GVVSAEIVSEVPNWLTYDFPPAVKAKVNRLWGGEWHGQAQKWY 103




GO:0004081 "bis(5'-nucleosyl)-tetraphosphatase (asymmetrical) activity" evidence=ISS;IDA
GO:0009507 "chloroplast" evidence=ISM
GO:0015967 "diadenosine tetraphosphate catabolic process" evidence=IDA
GO:0006857 "oligopeptide transport" evidence=RCA
GO:0019243 "methylglyoxal catabolic process to D-lactate" evidence=RCA
GO:0006753 "nucleoside phosphate metabolic process" evidence=IDA
GO:0008893 "guanosine-3',5'-bis(diphosphate) 3'-diphosphatase activity" evidence=IDA
TAIR|locus:2075840 NUDX26 "AT3G10620" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2164220 NUDX27 "AT5G06340" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_3585 SPO_3585 "hydrolase, NUDIX family, NudH subfamily" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
TIGR_CMR|CJE_0684 CJE_0684 "(di)nucleoside polyphosphate hydrolase" [Campylobacter jejuni RM1221 (taxid:195099)] Back     alignment and assigned GO terms
UNIPROTKB|Q9KU53 rppH "RNA pyrophosphohydrolase" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms
TIGR_CMR|VC_0671 VC_0671 "MutT/nudix family protein" [Vibrio cholerae O1 biovar El Tor (taxid:686)] Back     alignment and assigned GO terms
UNIPROTKB|P0A776 rppH [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
UNIPROTKB|Q47Y27 rppH "RNA pyrophosphohydrolase" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_3625 CPS_3625 "(di)nucleoside polyphosphate hydrolase" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9C6Z2NUD25_ARATH3, ., 6, ., 1, ., 1, 70.88340.79840.5885yesno
B9KN59RPPH_RHOSK3, ., 6, ., 1, ., -0.50940.77510.6172yesno
A1B502RPPH_PARDP3, ., 6, ., 1, ., -0.51370.78290.6196yesno
Q3IZC1RPPH_RHOS43, ., 6, ., 1, ., -0.50940.77510.6172yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.6.10.963
3rd Layer3.6.1.170.946

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00030498001
SubName- Full=Putative uncharacterized protein (Chromosome chr1 scaffold_5, whole genome shotgun sequence); (173 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00002216001
SubName- Full=Chromosome chr14 scaffold_128, whole genome shotgun sequence; (485 aa)
       0.507
GSVIVG00011801001
SubName- Full=Chromosome undetermined scaffold_339, whole genome shotgun sequence; (252 aa)
      0.478
GSVIVG00028703001
SubName- Full=Chromosome chr13 scaffold_45, whole genome shotgun sequence; (621 aa)
       0.448
GSVIVG00016858001
SubName- Full=Chromosome chr11 scaffold_13, whole genome shotgun sequence; (405 aa)
       0.423
GSVIVG00030263001
SubName- Full=Chromosome chr1 scaffold_5, whole genome shotgun sequence; (142 aa)
       0.420
GSVIVG00035080001
SubName- Full=Chromosome chr1 scaffold_75, whole genome shotgun sequence; (104 aa)
      0.404
GSVIVG00032518001
SubName- Full=Chromosome chr4 scaffold_6, whole genome shotgun sequence; (169 aa)
      0.400

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query129
cd03671147 cd03671, Ap4A_hydrolase_plant_like, Diadenosine te 7e-51
PRK00714156 PRK00714, PRK00714, RNA pyrophosphohydrolase; Revi 8e-44
pfam00293133 pfam00293, NUDIX, NUDIX domain 2e-17
cd02883123 cd02883, Nudix_Hydrolase, Nudix hydrolase is a sup 2e-12
COG0494161 COG0494, MutT, NTP pyrophosphohydrolases including 5e-12
PRK10776129 PRK10776, PRK10776, nucleoside triphosphate pyroph 7e-10
cd04664129 cd04664, Nudix_Hydrolase_7, Members of the Nudix h 4e-09
cd04684128 cd04684, Nudix_Hydrolase_25, Contains a crystal st 5e-09
cd04676129 cd04676, Nudix_Hydrolase_17, Members of the Nudix 6e-09
cd03424137 cd03424, ADPRase_NUDT5, ADP-ribose pyrophosphatase 8e-09
cd04700142 cd04700, DR1025_like, DR1025 from Deinococcus radi 4e-08
cd04685133 cd04685, Nudix_Hydrolase_26, Members of the Nudix 4e-08
COG1051145 COG1051, COG1051, ADP-ribose pyrophosphatase [Nucl 9e-08
cd03425124 cd03425, MutT_pyrophosphohydrolase, The MutT pyrop 1e-07
PRK09438148 PRK09438, nudB, dihydroneopterin triphosphate pyro 2e-07
cd04680120 cd04680, Nudix_Hydrolase_21, Members of the Nudix 2e-07
cd03428130 cd03428, Ap4A_hydrolase_human_like, Diadenosine te 2e-07
cd04670127 cd04670, Nudix_Hydrolase_12, Members of the Nudix 3e-07
cd04699129 cd04699, Nudix_Hydrolase_39, Members of the Nudix 3e-07
cd04683120 cd04683, Nudix_Hydrolase_24, Members of the Nudix 7e-07
TIGR00586128 TIGR00586, mutt, mutator mutT protein 9e-07
cd04686131 cd04686, Nudix_Hydrolase_27, Members of the Nudix 9e-07
cd04677132 cd04677, Nudix_Hydrolase_18, Members of the Nudix 1e-06
cd04667112 cd04667, Nudix_Hydrolase_10, Members of the Nudix 2e-06
cd04673122 cd04673, Nudix_Hydrolase_15, Members of the Nudix 2e-06
cd04662126 cd04662, Nudix_Hydrolase_5, Members of the Nudix h 2e-06
cd04681130 cd04681, Nudix_Hydrolase_22, Members of the Nudix 5e-06
cd03673131 cd03673, Ap6A_hydrolase, Diadenosine hexaphosphate 5e-06
cd04695131 cd04695, Nudix_Hydrolase_36, Members of the Nudix 6e-06
cd04682122 cd04682, Nudix_Hydrolase_23, Members of the Nudix 8e-06
PRK08999 312 PRK08999, PRK08999, hypothetical protein; Provisio 9e-06
cd04690118 cd04690, Nudix_Hydrolase_31, Members of the Nudix 1e-05
COG4119161 COG4119, COG4119, Predicted NTP pyrophosphohydrola 1e-05
cd03427137 cd03427, MTH1, MutT homolog-1 (MTH1) is a member o 1e-05
cd04678129 cd04678, Nudix_Hydrolase_19, Members of the Nudix 2e-05
cd03674138 cd03674, Nudix_Hydrolase_1, Members of the Nudix h 3e-05
cd04669121 cd04669, Nudix_Hydrolase_11, Members of the Nudix 3e-05
PRK15472141 PRK15472, PRK15472, nucleoside triphosphatase NudI 4e-05
PRK10546135 PRK10546, PRK10546, pyrimidine (deoxy)nucleoside t 4e-05
cd04663126 cd04663, Nudix_Hydrolase_6, Members of the Nudix h 6e-05
cd04666122 cd04666, Nudix_Hydrolase_9, Members of the Nudix h 9e-05
TIGR02705156 TIGR02705, nudix_YtkD, nucleoside triphosphatase Y 1e-04
cd04665118 cd04665, Nudix_Hydrolase_8, Members of the Nudix h 1e-04
cd04674118 cd04674, Nudix_Hydrolase_16, Members of the Nudix 6e-04
cd04696125 cd04696, Nudix_Hydrolase_37, Members of the Nudix 6e-04
cd04694143 cd04694, Nudix_Hydrolase_35, Members of the Nudix 9e-04
cd04691117 cd04691, Nudix_Hydrolase_32, Members of the Nudix 0.001
PRK11762185 PRK11762, nudE, adenosine nucleotide hydrolase Nud 0.001
cd04671123 cd04671, Nudix_Hydrolase_13, Members of the Nudix 0.001
cd04697126 cd04697, Nudix_Hydrolase_38, Members of the Nudix 0.001
cd04693127 cd04693, Nudix_Hydrolase_34, Members of the Nudix 0.004
>gnl|CDD|239643 cd03671, Ap4A_hydrolase_plant_like, Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily Back     alignment and domain information
 Score =  157 bits (400), Expect = 7e-51
 Identities = 59/100 (59%), Positives = 74/100 (74%), Gaps = 5/100 (5%)

Query: 7   GYRPNVGVCLINSDSQIFVASRLNVPGAWQMPQGGIEDGEDPKLAAMRELREETGI--VS 64
            YRPNVGV L N D ++FV  R++ PGAWQ PQGGI++GEDP+ AA+REL EETG+   S
Sbjct: 1   PYRPNVGVVLFNEDGKVFVGRRIDTPGAWQFPQGGIDEGEDPEQAALRELEEETGLDPDS 60

Query: 65  AEIIAEVPNWLTYDFPPAVKTKVNRLWGGEWHGQAQKWYA 104
            EIIAE+P+WL YD PP +K K   +WGG + GQ QKW+ 
Sbjct: 61  VEIIAEIPDWLRYDLPPELKLK---IWGGRYRGQEQKWFL 97


Members of this family are well represented in a variety of prokaryotic and eukaryotic organisms. Phylogenetic analysis reveals two distinct subgroups where plant enzymes fall into one group (represented by this subfamily) and fungi/animals/archaea enzymes fall into another. Bacterial enzymes are found in both subfamilies. Ap4A is a potential by-product of aminoacyl tRNA synthesis, and accumulation of Ap4A has been implicated in a range of biological events, such as DNA replication, cellular differentiation, heat shock, metabolic stress, and apoptosis. Ap4A hydrolase cleaves Ap4A asymmetrically into ATP and AMP. It is important in the invasive properties of bacteria and thus presents a potential target for the inhibition of such invasive bacteria. Besides the signature nudix motif (G[X5]E[X7]REUXEEXGU where U is Ile, Leu, or Val), Ap4A hydrolase is structurally similar to the other members of the nudix superfamily with some degree of variations. Several regions in the sequences are poorly defined and substrate and metal binding sites are only predicted based on kinetic studies. Length = 147

>gnl|CDD|234820 PRK00714, PRK00714, RNA pyrophosphohydrolase; Reviewed Back     alignment and domain information
>gnl|CDD|215841 pfam00293, NUDIX, NUDIX domain Back     alignment and domain information
>gnl|CDD|239217 cd02883, Nudix_Hydrolase, Nudix hydrolase is a superfamily of enzymes found in all three kingdoms of life, and it catalyzes the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|223568 COG0494, MutT, NTP pyrophosphohydrolases including oxidative damage repair enzymes [DNA replication, recombination, and repair / General function prediction only] Back     alignment and domain information
>gnl|CDD|182721 PRK10776, PRK10776, nucleoside triphosphate pyrophosphohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|240022 cd04664, Nudix_Hydrolase_7, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|240040 cd04684, Nudix_Hydrolase_25, Contains a crystal structure of the Nudix hydrolase from Enterococcus faecalis, which has an unknown function Back     alignment and domain information
>gnl|CDD|240032 cd04676, Nudix_Hydrolase_17, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|239516 cd03424, ADPRase_NUDT5, ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose and a variety of additional ADP-sugar conjugates to AMP and ribose-5-phosphate Back     alignment and domain information
>gnl|CDD|240055 cd04700, DR1025_like, DR1025 from Deinococcus radiodurans, a member of the Nudix hydrolase superfamily, show nucleoside triphosphatase and dinucleoside polyphosphate pyrophosphatase activities Back     alignment and domain information
>gnl|CDD|240041 cd04685, Nudix_Hydrolase_26, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|223979 COG1051, COG1051, ADP-ribose pyrophosphatase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|239517 cd03425, MutT_pyrophosphohydrolase, The MutT pyrophosphohydrolase is a prototypical Nudix hydrolase that catalyzes the hydrolysis of nucleoside and deoxynucleoside triphosphates (NTPs and dNTPs) by substitution at a beta-phosphorus to yield a nucleotide monophosphate (NMP) and inorganic pyrophosphate (PPi) Back     alignment and domain information
>gnl|CDD|236516 PRK09438, nudB, dihydroneopterin triphosphate pyrophosphatase; Provisional Back     alignment and domain information
>gnl|CDD|240036 cd04680, Nudix_Hydrolase_21, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|239520 cd03428, Ap4A_hydrolase_human_like, Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>gnl|CDD|240027 cd04670, Nudix_Hydrolase_12, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|240054 cd04699, Nudix_Hydrolase_39, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|240039 cd04683, Nudix_Hydrolase_24, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|200031 TIGR00586, mutt, mutator mutT protein Back     alignment and domain information
>gnl|CDD|240042 cd04686, Nudix_Hydrolase_27, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|240033 cd04677, Nudix_Hydrolase_18, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|240025 cd04667, Nudix_Hydrolase_10, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|240030 cd04673, Nudix_Hydrolase_15, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|240020 cd04662, Nudix_Hydrolase_5, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|240037 cd04681, Nudix_Hydrolase_22, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|239645 cd03673, Ap6A_hydrolase, Diadenosine hexaphosphate (Ap6A) hydrolase is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>gnl|CDD|240051 cd04695, Nudix_Hydrolase_36, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|240038 cd04682, Nudix_Hydrolase_23, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|236361 PRK08999, PRK08999, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|240046 cd04690, Nudix_Hydrolase_31, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|226604 COG4119, COG4119, Predicted NTP pyrophosphohydrolase [DNA replication, recombination, and repair / General function prediction only] Back     alignment and domain information
>gnl|CDD|239519 cd03427, MTH1, MutT homolog-1 (MTH1) is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>gnl|CDD|240034 cd04678, Nudix_Hydrolase_19, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|239646 cd03674, Nudix_Hydrolase_1, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|240026 cd04669, Nudix_Hydrolase_11, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|185369 PRK15472, PRK15472, nucleoside triphosphatase NudI; Provisional Back     alignment and domain information
>gnl|CDD|182536 PRK10546, PRK10546, pyrimidine (deoxy)nucleoside triphosphate pyrophosphohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|240021 cd04663, Nudix_Hydrolase_6, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|240024 cd04666, Nudix_Hydrolase_9, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|131752 TIGR02705, nudix_YtkD, nucleoside triphosphatase YtkD Back     alignment and domain information
>gnl|CDD|240023 cd04665, Nudix_Hydrolase_8, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|240031 cd04674, Nudix_Hydrolase_16, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|240052 cd04696, Nudix_Hydrolase_37, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|240050 cd04694, Nudix_Hydrolase_35, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|240047 cd04691, Nudix_Hydrolase_32, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|183303 PRK11762, nudE, adenosine nucleotide hydrolase NudE; Provisional Back     alignment and domain information
>gnl|CDD|240028 cd04671, Nudix_Hydrolase_13, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|240053 cd04697, Nudix_Hydrolase_38, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|240049 cd04693, Nudix_Hydrolase_34, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 129
PRK09438148 nudB dihydroneopterin triphosphate pyrophosphatase 99.87
PRK00714156 RNA pyrophosphohydrolase; Reviewed 99.86
cd03671147 Ap4A_hydrolase_plant_like Diadenosine tetraphospha 99.86
PRK15434159 GDP-mannose mannosyl hydrolase NudD; Provisional 99.86
cd04679125 Nudix_Hydrolase_20 Members of the Nudix hydrolase 99.85
cd04681130 Nudix_Hydrolase_22 Members of the Nudix hydrolase 99.84
PLN02325144 nudix hydrolase 99.84
cd03430144 GDPMH GDP-mannose glycosyl hydrolase (AKA GDP-mann 99.83
cd04669121 Nudix_Hydrolase_11 Members of the Nudix hydrolase 99.82
cd03673131 Ap6A_hydrolase Diadenosine hexaphosphate (Ap6A) hy 99.82
cd04676129 Nudix_Hydrolase_17 Members of the Nudix hydrolase 99.82
cd03672145 Dcp2p mRNA decapping enzyme 2 (Dcp2p), the catalyt 99.82
cd04696125 Nudix_Hydrolase_37 Members of the Nudix hydrolase 99.82
cd04671123 Nudix_Hydrolase_13 Members of the Nudix hydrolase 99.81
cd04691117 Nudix_Hydrolase_32 Members of the Nudix hydrolase 99.81
cd03674138 Nudix_Hydrolase_1 Members of the Nudix hydrolase s 99.81
cd04684128 Nudix_Hydrolase_25 Contains a crystal structure of 99.81
cd04700142 DR1025_like DR1025 from Deinococcus radiodurans, a 99.81
cd04680120 Nudix_Hydrolase_21 Members of the Nudix hydrolase 99.81
cd03427137 MTH1 MutT homolog-1 (MTH1) is a member of the Nudi 99.81
PRK15472141 nucleoside triphosphatase NudI; Provisional 99.81
cd04677132 Nudix_Hydrolase_18 Members of the Nudix hydrolase 99.8
cd04664129 Nudix_Hydrolase_7 Members of the Nudix hydrolase s 99.8
cd04670127 Nudix_Hydrolase_12 Members of the Nudix hydrolase 99.8
cd04683120 Nudix_Hydrolase_24 Members of the Nudix hydrolase 99.8
cd04678129 Nudix_Hydrolase_19 Members of the Nudix hydrolase 99.8
COG1051145 ADP-ribose pyrophosphatase [Nucleotide transport a 99.8
cd03428130 Ap4A_hydrolase_human_like Diadenosine tetraphospha 99.8
cd04687128 Nudix_Hydrolase_28 Members of the Nudix hydrolase 99.79
PF00293134 NUDIX: NUDIX domain; InterPro: IPR000086 The gener 99.79
cd04697126 Nudix_Hydrolase_38 Members of the Nudix hydrolase 99.78
cd04682122 Nudix_Hydrolase_23 Members of the Nudix hydrolase 99.78
cd04695131 Nudix_Hydrolase_36 Members of the Nudix hydrolase 99.78
cd04689125 Nudix_Hydrolase_30 Members of the Nudix hydrolase 99.78
cd04673122 Nudix_Hydrolase_15 Members of the Nudix hydrolase 99.78
cd04511130 Nudix_Hydrolase_4 Members of the Nudix hydrolase s 99.78
cd04690118 Nudix_Hydrolase_31 Members of the Nudix hydrolase 99.77
cd04672123 Nudix_Hydrolase_14 Members of the Nudix hydrolase 99.77
cd04688126 Nudix_Hydrolase_29 Members of the Nudix hydrolase 99.77
cd04666122 Nudix_Hydrolase_9 Members of the Nudix hydrolase s 99.77
cd03424137 ADPRase_NUDT5 ADP-ribose pyrophosphatase (ADPRase) 99.77
cd04693127 Nudix_Hydrolase_34 Members of the Nudix hydrolase 99.77
cd02885165 IPP_Isomerase Isopentenyl diphosphate (IPP) isomer 99.77
cd04692144 Nudix_Hydrolase_33 Members of the Nudix hydrolase 99.76
cd03426157 CoAse Coenzyme A pyrophosphatase (CoAse), a member 99.76
cd03429131 NADH_pyrophosphatase NADH pyrophosphatase, a membe 99.76
PRK10546135 pyrimidine (deoxy)nucleoside triphosphate pyrophos 99.75
PRK10776129 nucleoside triphosphate pyrophosphohydrolase; Prov 99.75
PRK15393180 NUDIX hydrolase YfcD; Provisional 99.75
cd03675134 Nudix_Hydrolase_2 Contains a crystal structure of 99.75
cd04699129 Nudix_Hydrolase_39 Members of the Nudix hydrolase 99.74
cd04686131 Nudix_Hydrolase_27 Members of the Nudix hydrolase 99.74
PRK03759184 isopentenyl-diphosphate delta-isomerase; Provision 99.74
TIGR00586128 mutt mutator mutT protein. All proteins in this fa 99.73
cd04667112 Nudix_Hydrolase_10 Members of the Nudix hydrolase 99.73
cd04694143 Nudix_Hydrolase_35 Members of the Nudix hydrolase 99.73
cd04661132 MRP_L46 Mitochondrial ribosomal protein L46 (MRP L 99.73
TIGR02150158 IPP_isom_1 isopentenyl-diphosphate delta-isomerase 99.72
PRK00241256 nudC NADH pyrophosphatase; Reviewed 99.7
cd04685133 Nudix_Hydrolase_26 Members of the Nudix hydrolase 99.7
PRK05379340 bifunctional nicotinamide mononucleotide adenylylt 99.69
cd03425124 MutT_pyrophosphohydrolase The MutT pyrophosphohydr 99.68
cd02883123 Nudix_Hydrolase Nudix hydrolase is a superfamily o 99.67
PRK11762185 nudE adenosine nucleotide hydrolase NudE; Provisio 99.66
PRK10707190 putative NUDIX hydrolase; Provisional 99.64
cd04665118 Nudix_Hydrolase_8 Members of the Nudix hydrolase s 99.64
cd04674118 Nudix_Hydrolase_16 Members of the Nudix hydrolase 99.63
PRK08999 312 hypothetical protein; Provisional 99.61
cd04662126 Nudix_Hydrolase_5 Members of the Nudix hydrolase s 99.61
cd04663126 Nudix_Hydrolase_6 Members of the Nudix hydrolase s 99.61
KOG2839145 consensus Diadenosine and diphosphoinositol polyph 99.6
cd03676180 Nudix_hydrolase_3 Members of the Nudix hydrolase s 99.6
TIGR00052185 nudix-type nucleoside diphosphatase, YffH/AdpP fam 99.59
PRK10729202 nudF ADP-ribose pyrophosphatase NudF; Provisional 99.57
TIGR02705156 nudix_YtkD nucleoside triphosphatase YtkD. The fun 99.57
PLN02709222 nudix hydrolase 99.5
COG0494161 MutT NTP pyrophosphohydrolases including oxidative 99.45
KOG3084345 consensus NADH pyrophosphatase I of the Nudix fami 99.44
cd03670186 ADPRase_NUDT9 ADP-ribose pyrophosphatase (ADPRase) 99.44
PRK15009191 GDP-mannose pyrophosphatase NudK; Provisional 99.42
COG2816279 NPY1 NTP pyrophosphohydrolases containing a Zn-fin 99.42
PLN02791 770 Nudix hydrolase homolog 99.33
PLN02552247 isopentenyl-diphosphate delta-isomerase 99.33
PLN03143291 nudix hydrolase; Provisional 99.24
cd03431118 DNA_Glycosylase_C DNA glycosylase (MutY in bacteri 99.1
KOG3041225 consensus Nucleoside diphosphate-sugar hydrolase o 99.05
KOG3069246 consensus Peroxisomal NUDIX hydrolase [Replication 98.99
COG1443185 Idi Isopentenyldiphosphate isomerase [Lipid metabo 98.93
KOG0648295 consensus Predicted NUDIX hydrolase FGF-2 and rela 98.93
COG4119161 Predicted NTP pyrophosphohydrolase [DNA replicatio 98.66
PF14815114 NUDIX_4: NUDIX domain; PDB: 1VRL_A 1RRQ_A 3G0Q_A 3 98.24
PLN02839372 nudix hydrolase 98.19
KOG4195275 consensus Transient receptor potential-related cha 98.13
KOG2937 348 consensus Decapping enzyme complex, predicted pyro 97.7
PF13869188 NUDIX_2: Nucleotide hydrolase; PDB: 3MDG_B 2J8Q_B 97.51
KOG0142225 consensus Isopentenyl pyrophosphate:dimethylallyl 96.75
KOG1689221 consensus mRNA cleavage factor I subunit [RNA proc 96.5
KOG4432 405 consensus Uncharacterized NUDIX family hydrolase [ 95.75
COG4112203 Predicted phosphoesterase (MutT family) [General f 95.27
KOG4313306 consensus Thiamine pyrophosphokinase [Nucleotide t 95.05
PRK10880350 adenine DNA glycosylase; Provisional 94.27
KOG4548263 consensus Mitochondrial ribosomal protein L17 [Tra 92.48
TIGR01084275 mutY A/G-specific adenine glycosylase. This equiva 91.6
KOG4432405 consensus Uncharacterized NUDIX family hydrolase [ 89.81
PF14443126 DBC1: DBC1 89.05
PRK13910289 DNA glycosylase MutY; Provisional 86.17
PF0348743 IL13: Interleukin-13; InterPro: IPR020470 Interleu 80.54
>PRK09438 nudB dihydroneopterin triphosphate pyrophosphatase; Provisional Back     alignment and domain information
Probab=99.87  E-value=3.6e-22  Score=135.30  Aligned_cols=58  Identities=34%  Similarity=0.555  Sum_probs=53.6

Q ss_pred             CCcCEEEEEEEeCCCcEEEEEEcCCCCcEEcCeeecCCCCCHHHHHHHHHHHHhCCce
Q 033022            7 GYRPNVGVCLINSDSQIFVASRLNVPGAWQMPQGGIEDGEDPKLAAMRELREETGIVS   64 (129)
Q Consensus         7 ~~~~~~~~~i~~~~~~vLl~~r~~~~g~w~~PgG~ve~gEs~~~aa~RE~~EEtGl~~   64 (129)
                      ..+.+|++++++.++++||++|...++.|++|||++|+|||+.+||+||++||||+++
T Consensus         5 ~~~~~v~~vi~~~~~~vLl~~r~~~~~~W~lPgG~ve~gEs~~~aa~REl~EEtGl~~   62 (148)
T PRK09438          5 KRPVSVLVVIYTPDLGVLMLQRADDPDFWQSVTGSLEEGETPAQTAIREVKEETGIDV   62 (148)
T ss_pred             cCceEEEEEEEeCCCeEEEEEecCCCCcEeCCcccCCCCCCHHHHHHHHHHHHhCcCc
Confidence            3677899999999999999999876789999999999999999999999999999986



>PRK00714 RNA pyrophosphohydrolase; Reviewed Back     alignment and domain information
>cd03671 Ap4A_hydrolase_plant_like Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>PRK15434 GDP-mannose mannosyl hydrolase NudD; Provisional Back     alignment and domain information
>cd04679 Nudix_Hydrolase_20 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04681 Nudix_Hydrolase_22 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PLN02325 nudix hydrolase Back     alignment and domain information
>cd03430 GDPMH GDP-mannose glycosyl hydrolase (AKA GDP-mannose mannosyl hydrolase (GDPMH)) is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>cd04669 Nudix_Hydrolase_11 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03673 Ap6A_hydrolase Diadenosine hexaphosphate (Ap6A) hydrolase is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>cd04676 Nudix_Hydrolase_17 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03672 Dcp2p mRNA decapping enzyme 2 (Dcp2p), the catalytic subunit, and Dcp1p are the two components of the decapping enzyme complex Back     alignment and domain information
>cd04696 Nudix_Hydrolase_37 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04671 Nudix_Hydrolase_13 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04691 Nudix_Hydrolase_32 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03674 Nudix_Hydrolase_1 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04684 Nudix_Hydrolase_25 Contains a crystal structure of the Nudix hydrolase from Enterococcus faecalis, which has an unknown function Back     alignment and domain information
>cd04700 DR1025_like DR1025 from Deinococcus radiodurans, a member of the Nudix hydrolase superfamily, show nucleoside triphosphatase and dinucleoside polyphosphate pyrophosphatase activities Back     alignment and domain information
>cd04680 Nudix_Hydrolase_21 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03427 MTH1 MutT homolog-1 (MTH1) is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>PRK15472 nucleoside triphosphatase NudI; Provisional Back     alignment and domain information
>cd04677 Nudix_Hydrolase_18 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04664 Nudix_Hydrolase_7 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04670 Nudix_Hydrolase_12 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04683 Nudix_Hydrolase_24 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04678 Nudix_Hydrolase_19 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>COG1051 ADP-ribose pyrophosphatase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd03428 Ap4A_hydrolase_human_like Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>cd04687 Nudix_Hydrolase_28 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PF00293 NUDIX: NUDIX domain; InterPro: IPR000086 The generic name 'NUDIX hydrolases' (NUcleoside DIphosphate linked to some other moiety X) has been coined for this domain family [] Back     alignment and domain information
>cd04697 Nudix_Hydrolase_38 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04682 Nudix_Hydrolase_23 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04695 Nudix_Hydrolase_36 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04689 Nudix_Hydrolase_30 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04673 Nudix_Hydrolase_15 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04511 Nudix_Hydrolase_4 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04690 Nudix_Hydrolase_31 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04672 Nudix_Hydrolase_14 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04688 Nudix_Hydrolase_29 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04666 Nudix_Hydrolase_9 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03424 ADPRase_NUDT5 ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose and a variety of additional ADP-sugar conjugates to AMP and ribose-5-phosphate Back     alignment and domain information
>cd04693 Nudix_Hydrolase_34 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd02885 IPP_Isomerase Isopentenyl diphosphate (IPP) isomerase, a member of the Nudix hydrolase superfamily, is a key enzyme in the isoprenoid biosynthetic pathway Back     alignment and domain information
>cd04692 Nudix_Hydrolase_33 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03426 CoAse Coenzyme A pyrophosphatase (CoAse), a member of the Nudix hydrolase superfamily, functions to catalyze the elimination of oxidized inactive CoA, which can inhibit CoA-utilizing enzymes Back     alignment and domain information
>cd03429 NADH_pyrophosphatase NADH pyrophosphatase, a member of the Nudix hydrolase superfamily, catalyzes the cleavage of NADH into reduced nicotinamide mononucleotide (NMNH) and AMP Back     alignment and domain information
>PRK10546 pyrimidine (deoxy)nucleoside triphosphate pyrophosphohydrolase; Provisional Back     alignment and domain information
>PRK10776 nucleoside triphosphate pyrophosphohydrolase; Provisional Back     alignment and domain information
>PRK15393 NUDIX hydrolase YfcD; Provisional Back     alignment and domain information
>cd03675 Nudix_Hydrolase_2 Contains a crystal structure of the Nudix hydrolase from Nitrosomonas europaea, which has an unknown function Back     alignment and domain information
>cd04699 Nudix_Hydrolase_39 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04686 Nudix_Hydrolase_27 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PRK03759 isopentenyl-diphosphate delta-isomerase; Provisional Back     alignment and domain information
>TIGR00586 mutt mutator mutT protein Back     alignment and domain information
>cd04667 Nudix_Hydrolase_10 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04694 Nudix_Hydrolase_35 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04661 MRP_L46 Mitochondrial ribosomal protein L46 (MRP L46) is a component of the large subunit (39S) of the mammalian mitochondrial ribosome and a member of the Nudix hydrolase superfamily Back     alignment and domain information
>TIGR02150 IPP_isom_1 isopentenyl-diphosphate delta-isomerase, type 1 Back     alignment and domain information
>PRK00241 nudC NADH pyrophosphatase; Reviewed Back     alignment and domain information
>cd04685 Nudix_Hydrolase_26 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PRK05379 bifunctional nicotinamide mononucleotide adenylyltransferase/ADP-ribose pyrophosphatase; Provisional Back     alignment and domain information
>cd03425 MutT_pyrophosphohydrolase The MutT pyrophosphohydrolase is a prototypical Nudix hydrolase that catalyzes the hydrolysis of nucleoside and deoxynucleoside triphosphates (NTPs and dNTPs) by substitution at a beta-phosphorus to yield a nucleotide monophosphate (NMP) and inorganic pyrophosphate (PPi) Back     alignment and domain information
>cd02883 Nudix_Hydrolase Nudix hydrolase is a superfamily of enzymes found in all three kingdoms of life, and it catalyzes the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PRK11762 nudE adenosine nucleotide hydrolase NudE; Provisional Back     alignment and domain information
>PRK10707 putative NUDIX hydrolase; Provisional Back     alignment and domain information
>cd04665 Nudix_Hydrolase_8 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04674 Nudix_Hydrolase_16 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PRK08999 hypothetical protein; Provisional Back     alignment and domain information
>cd04662 Nudix_Hydrolase_5 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04663 Nudix_Hydrolase_6 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>KOG2839 consensus Diadenosine and diphosphoinositol polyphosphate phosphohydrolase [Signal transduction mechanisms] Back     alignment and domain information
>cd03676 Nudix_hydrolase_3 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>TIGR00052 nudix-type nucleoside diphosphatase, YffH/AdpP family Back     alignment and domain information
>PRK10729 nudF ADP-ribose pyrophosphatase NudF; Provisional Back     alignment and domain information
>TIGR02705 nudix_YtkD nucleoside triphosphatase YtkD Back     alignment and domain information
>PLN02709 nudix hydrolase Back     alignment and domain information
>COG0494 MutT NTP pyrophosphohydrolases including oxidative damage repair enzymes [DNA replication, recombination, and repair / General function prediction only] Back     alignment and domain information
>KOG3084 consensus NADH pyrophosphatase I of the Nudix family of hydrolases [Replication, recombination and repair] Back     alignment and domain information
>cd03670 ADPRase_NUDT9 ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose to AMP and ribose-5-P Back     alignment and domain information
>PRK15009 GDP-mannose pyrophosphatase NudK; Provisional Back     alignment and domain information
>COG2816 NPY1 NTP pyrophosphohydrolases containing a Zn-finger, probably nucleic-acid-binding [DNA replication, recombination, and repair] Back     alignment and domain information
>PLN02791 Nudix hydrolase homolog Back     alignment and domain information
>PLN02552 isopentenyl-diphosphate delta-isomerase Back     alignment and domain information
>PLN03143 nudix hydrolase; Provisional Back     alignment and domain information
>cd03431 DNA_Glycosylase_C DNA glycosylase (MutY in bacteria and hMYH in humans) is responsible for repairing misread A*oxoG residues to C*G by removing the inappropriately paired adenine base from the DNA backbone Back     alignment and domain information
>KOG3041 consensus Nucleoside diphosphate-sugar hydrolase of the MutT (NUDIX) family [Replication, recombination and repair] Back     alignment and domain information
>KOG3069 consensus Peroxisomal NUDIX hydrolase [Replication, recombination and repair] Back     alignment and domain information
>COG1443 Idi Isopentenyldiphosphate isomerase [Lipid metabolism] Back     alignment and domain information
>KOG0648 consensus Predicted NUDIX hydrolase FGF-2 and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>COG4119 Predicted NTP pyrophosphohydrolase [DNA replication, recombination, and repair / General function prediction only] Back     alignment and domain information
>PF14815 NUDIX_4: NUDIX domain; PDB: 1VRL_A 1RRQ_A 3G0Q_A 3FSQ_A 1RRS_A 3FSP_A Back     alignment and domain information
>PLN02839 nudix hydrolase Back     alignment and domain information
>KOG4195 consensus Transient receptor potential-related channel 7 [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG2937 consensus Decapping enzyme complex, predicted pyrophosphatase DCP2 [RNA processing and modification] Back     alignment and domain information
>PF13869 NUDIX_2: Nucleotide hydrolase; PDB: 3MDG_B 2J8Q_B 3Q2S_A 3P5T_D 3BAP_A 2CL3_A 3P6Y_A 3Q2T_B 3BHO_A 3N9U_A Back     alignment and domain information
>KOG0142 consensus Isopentenyl pyrophosphate:dimethylallyl pyrophosphate isomerase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG1689 consensus mRNA cleavage factor I subunit [RNA processing and modification] Back     alignment and domain information
>KOG4432 consensus Uncharacterized NUDIX family hydrolase [General function prediction only] Back     alignment and domain information
>COG4112 Predicted phosphoesterase (MutT family) [General function prediction only] Back     alignment and domain information
>KOG4313 consensus Thiamine pyrophosphokinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK10880 adenine DNA glycosylase; Provisional Back     alignment and domain information
>KOG4548 consensus Mitochondrial ribosomal protein L17 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01084 mutY A/G-specific adenine glycosylase Back     alignment and domain information
>KOG4432 consensus Uncharacterized NUDIX family hydrolase [General function prediction only] Back     alignment and domain information
>PF14443 DBC1: DBC1 Back     alignment and domain information
>PRK13910 DNA glycosylase MutY; Provisional Back     alignment and domain information
>PF03487 IL13: Interleukin-13; InterPro: IPR020470 Interleukin-13 (IL-13) is a pleiotropic cytokine which may be important in the regulation of the inflammatory and immune responses [] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query129
1f3y_A165 Solution Structure Of The Nudix Enzyme Diadenosine 1e-40
2kdv_A164 Solution Structure Of Rna Pyrophosphohydrolase Rpph 5e-12
2kdw_A164 Solution Structure Of Rpph Mutant E53a From Escheri 2e-11
1sjy_A159 Crystal Structure Of Nudix Hydrolase Dr1025 From De 3e-06
3hhj_A158 Crystal Structure Of Mutator Mutt From Bartonella H 1e-04
3r03_A144 The Crystal Structure Of Nudix Hydrolase From Rhodo 2e-04
2fvv_A194 Human Diphosphoinositol Polyphosphate Phosphohydrol 3e-04
3ees_A153 Structure Of The Rna Pyrophosphohydrolase Bdrpph Le 3e-04
3i7u_A134 Crystal Structure Of Ap4a Hydrolase (Aq_158) From A 5e-04
>pdb|1F3Y|A Chain A, Solution Structure Of The Nudix Enzyme Diadenosine Tetraphosphate Hydrolase From Lupinus Angustifolius L. Length = 165 Back     alignment and structure

Iteration: 1

Score = 161 bits (407), Expect = 1e-40, Method: Compositional matrix adjust. Identities = 71/103 (68%), Positives = 87/103 (84%) Query: 1 MDGLPSGYRPNVGVCLINSDSQIFVASRLNVPGAWQMPQGGIEDGEDPKLAAMRELREET 60 MD P GYR NVG+CL+N+D +IF ASRL++P AWQMPQGGI++GEDP+ AA+RELREET Sbjct: 6 MDSPPEGYRRNVGICLMNNDKKIFAASRLDIPDAWQMPQGGIDEGEDPRNAAIRELREET 65 Query: 61 GIVSAEIIAEVPNWLTYDFPPAVKTKVNRLWGGEWHGQAQKWY 103 G+ SAE+IAEVP WLTYDFPP V+ K+N WG +W GQAQKW+ Sbjct: 66 GVTSAEVIAEVPYWLTYDFPPKVREKLNIQWGSDWKGQAQKWF 108
>pdb|2KDV|A Chain A, Solution Structure Of Rna Pyrophosphohydrolase Rpph From Escherichia Coli Length = 164 Back     alignment and structure
>pdb|2KDW|A Chain A, Solution Structure Of Rpph Mutant E53a From Escherichia Coli Length = 164 Back     alignment and structure
>pdb|1SJY|A Chain A, Crystal Structure Of Nudix Hydrolase Dr1025 From Deinococcus Radiodurans Length = 159 Back     alignment and structure
>pdb|3HHJ|A Chain A, Crystal Structure Of Mutator Mutt From Bartonella Henselae Length = 158 Back     alignment and structure
>pdb|3R03|A Chain A, The Crystal Structure Of Nudix Hydrolase From Rhodospirillum Rubrum Length = 144 Back     alignment and structure
>pdb|2FVV|A Chain A, Human Diphosphoinositol Polyphosphate Phosphohydrolase 1 Length = 194 Back     alignment and structure
>pdb|3EES|A Chain A, Structure Of The Rna Pyrophosphohydrolase Bdrpph Length = 153 Back     alignment and structure
>pdb|3I7U|A Chain A, Crystal Structure Of Ap4a Hydrolase (Aq_158) From Aquifex Aeolicus Vf5 Length = 134 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query129
1f3y_A165 Diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase 1e-56
2kdv_A164 RNA pyrophosphohydrolase; nudix family, magnesium, 1e-48
2o1c_A150 DATP pyrophosphohydrolase; nudix NTP hydrolase NTP 3e-27
1xsa_A153 BIS(5'-nucleosyl)-tetraphosphatase; nudix enzyme, 2e-20
1ktg_A138 Diadenosine tetraphosphate hydrolase; nudix, AMP, 4e-19
3son_A149 Hypothetical nudix hydrolase; structural genomics, 1e-14
3h95_A199 Nucleoside diphosphate-linked moiety X motif 6; NU 5e-12
2azw_A148 MUTT/nudix family protein; MUTT/nudix ,enterococcu 8e-12
3shd_A153 Phosphatase NUDJ; nudix fold, nudix motif, hydrola 1e-11
2a6t_A271 SPAC19A8.12; alpha/beta/alpha, RNA binding protein 1e-11
2fvv_A194 Diphosphoinositol polyphosphate phosphohydrolase 1 2e-11
1rya_A160 GDP-mannose mannosyl hydrolase; GDP-glucose, nudix 2e-11
3oga_A165 Nucleoside triphosphatase NUDI; salmonella enteric 2e-11
3id9_A171 MUTT/nudix family protein; hydrolase, protein stru 4e-11
3hhj_A158 Mutator MUTT protein; niaid, ssgcid, decode, UW, S 4e-11
2jvb_A146 Protein PSU1, mRNA-decapping enzyme subunit 2; DCP 5e-11
3grn_A153 MUTT related protein; structural genomics, hydrola 6e-11
2pbt_A134 AP4A hydrolase; nudix protein, diadenosine polypho 7e-11
3r03_A144 Nudix hydrolase; structural genomics, PSI2, protei 9e-11
1k2e_A156 Nudix homolog; nudix/MUTT-like fold, mixed alpha/b 1e-10
3gwy_A140 Putative CTP pyrophosphohydrolase; structural geno 1e-10
4dyw_A157 MUTT/nudix family protein; structural genomics, ni 2e-10
1vcd_A126 NDX1; nudix protein, diadenosine polyphosphate, AP 2e-10
2rrk_A140 ORF135, CTP pyrophosphohydrolase; NMR {Escherichia 2e-10
1sjy_A159 MUTT/nudix family protein; nudix fold, alpha-beta- 3e-10
3ees_A153 Probable pyrophosphohydrolase; nudix, RNA pyrophos 4e-10
2pqv_A154 MUTT/nudix family protein; structu genomics, PSI-2 4e-10
3gg6_A156 Nudix motif 18, nucleoside diphosphate-linked moie 5e-10
3f13_A163 Putative nudix hydrolase family member; structural 6e-10
2b0v_A153 Nudix hydrolase; structural genomics, PSI, protein 7e-10
3q1p_A205 Phosphohydrolase (MUTT/nudix family protein); asym 7e-10
3eds_A153 MUTT/nudix family protein; MUT/nudix protein, prot 9e-10
1mut_A129 MUTT, nucleoside triphosphate pyrophosphohydrolase 1e-09
3q93_A176 7,8-dihydro-8-oxoguanine triphosphatase; structura 2e-09
3cng_A189 Nudix hydrolase; structural genomics, APC7497, PSI 3e-09
1v8y_A170 ADP-ribose pyrophosphatase; nudix motif, loop-heli 4e-09
2w4e_A145 MUTT/nudix family protein; ADP-ribose pyrophosphat 4e-09
2yyh_A139 MUTT domain, 8-OXO-DGTPase domain; nudix family pr 1e-08
3o8s_A206 Nudix hydrolase, ADP-ribose pyrophosphatase; struc 1e-08
3fk9_A188 Mutator MUTT protein; structural genomics, hydrola 1e-08
3fjy_A 364 Probable MUTT1 protein; dimer, protein structure i 2e-08
2qjt_B352 Nicotinamide-nucleotide adenylyltransferase; two i 2e-08
1vhz_A198 ADP compounds hydrolase NUDE; structural genomics; 2e-08
2yvp_A182 NDX2, MUTT/nudix family protein; nudix protein, AD 3e-08
3f6a_A159 Hydrolase, nudix family; protein structure initiat 1e-07
2dsc_A212 ADP-sugar pyrophosphatase; nudix domain, ADPR, ADP 1e-07
3exq_A161 Nudix family hydrolase; protein structure initiati 1e-07
2b06_A155 MUTT/nudix family protein; structural genomics, P 1e-07
1mk1_A207 ADPR pyrophosphatase; nudix hydrolase, adprase, ad 2e-07
3i9x_A187 MUTT/nudix family protein; structural genomics, hy 2e-07
3fcm_A197 Hydrolase, nudix family; protein structure initiat 4e-07
1q27_A171 Putative nudix hydrolase DR0079; radiation resista 2e-06
2fkb_A180 Putative nudix hydrolase YFCD; putative protein, M 2e-06
2fml_A 273 MUTT/nudix family protein; structural genomics, PS 3e-06
2qjo_A341 Bifunctional NMN adenylyltransferase/nudix hydrol; 3e-06
1g0s_A209 Hypothetical 23.7 kDa protein in ICC-TOLC intergen 6e-06
1hzt_A190 Isopentenyl diphosphate delta-isomerase; dimethyla 3e-05
2fb1_A226 Conserved hypothetical protein; structural genomic 8e-05
3o6z_A191 GDP-mannose pyrophosphatase NUDK; nudix, hydrolase 1e-04
1q33_A292 Pyrophosphatase, ADP-ribose pyrophosphatase; nudix 2e-04
1nqz_A194 COA pyrophosphatase (MUTT/nudix family protein); D 3e-04
>1f3y_A Diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase; enzyme,mixed 4-stranded beta sheet, 2-stranded antiparallel sheet; NMR {Lupinus angustifolius} SCOP: d.113.1.1 PDB: 1jkn_A* Length = 165 Back     alignment and structure
 Score =  172 bits (439), Expect = 1e-56
 Identities = 71/104 (68%), Positives = 87/104 (83%)

Query: 1   MDGLPSGYRPNVGVCLINSDSQIFVASRLNVPGAWQMPQGGIEDGEDPKLAAMRELREET 60
           MD  P GYR NVG+CL+N+D +IF ASRL++P AWQMPQGGI++GEDP+ AA+RELREET
Sbjct: 6   MDSPPEGYRRNVGICLMNNDKKIFAASRLDIPDAWQMPQGGIDEGEDPRNAAIRELREET 65

Query: 61  GIVSAEIIAEVPNWLTYDFPPAVKTKVNRLWGGEWHGQAQKWYA 104
           G+ SAE+IAEVP WLTYDFPP V+ K+N  WG +W GQAQKW+ 
Sbjct: 66  GVTSAEVIAEVPYWLTYDFPPKVREKLNIQWGSDWKGQAQKWFL 109


>2kdv_A RNA pyrophosphohydrolase; nudix family, magnesium, manganese, zinc; NMR {Escherichia coli} PDB: 2kdw_A Length = 164 Back     alignment and structure
>2o1c_A DATP pyrophosphohydrolase; nudix NTP hydrolase NTP pyrophosphohydrolase MUTT dihydroneo triphosphate pyrophosphohydrolase folate biosynthesis; 1.80A {Escherichia coli} PDB: 2o5w_A Length = 150 Back     alignment and structure
>1xsa_A BIS(5'-nucleosyl)-tetraphosphatase; nudix enzyme, human AP4A hydrolase, alpha-beta; NMR {Homo sapiens} SCOP: d.113.1.1 PDB: 1xsb_A 1xsc_A* Length = 153 Back     alignment and structure
>1ktg_A Diadenosine tetraphosphate hydrolase; nudix, AMP, magnesium cluster; HET: AMP; 1.80A {Caenorhabditis elegans} SCOP: d.113.1.1 PDB: 1kt9_A* Length = 138 Back     alignment and structure
>3son_A Hypothetical nudix hydrolase; structural genomics, joint center for structural GENO JCSG, protein structure initiative, PSI-biology; HET: MSE; 1.71A {Listeria monocytogenes} Length = 149 Back     alignment and structure
>3h95_A Nucleoside diphosphate-linked moiety X motif 6; NUDT6, nudix, hydrolase, GFG, GFG-1, FGF2AS, structural GENO structural genomics consortium, SGC; HET: FLC; 1.70A {Homo sapiens} Length = 199 Back     alignment and structure
>2azw_A MUTT/nudix family protein; MUTT/nudix ,enterococcus faecalis, structural genomics, PSI, structure initiative; HET: 1PE; 1.90A {Enterococcus faecalis} SCOP: d.113.1.1 Length = 148 Back     alignment and structure
>3shd_A Phosphatase NUDJ; nudix fold, nudix motif, hydrolase, (D)NDP/(D)NTP binding, dephosphorylation; 2.50A {Escherichia coli} PDB: 3dku_A Length = 153 Back     alignment and structure
>2a6t_A SPAC19A8.12; alpha/beta/alpha, RNA binding protein,hydrolase; 2.50A {Schizosaccharomyces pombe} SCOP: a.242.1.1 d.113.1.7 PDB: 2qkm_B* Length = 271 Back     alignment and structure
>2fvv_A Diphosphoinositol polyphosphate phosphohydrolase 1; nudix, inositol polyphosphate metabolism, structural genomics, structural genomics consortium; HET: IHP; 1.25A {Homo sapiens} SCOP: d.113.1.1 PDB: 2q9p_A* 2duk_A 3mcf_A* Length = 194 Back     alignment and structure
>1rya_A GDP-mannose mannosyl hydrolase; GDP-glucose, nudix, nudix Mg-complex; HET: GDP; 1.30A {Escherichia coli} SCOP: d.113.1.5 PDB: 2gt2_A 2gt4_A* 2i8t_A* 2i8u_A* Length = 160 Back     alignment and structure
>3oga_A Nucleoside triphosphatase NUDI; salmonella enterica subsp. enterica serovar typhimurium STR. unknown function; HET: PO4; 1.75A {Salmonella enterica subsp} PDB: 3n77_A Length = 165 Back     alignment and structure
>3id9_A MUTT/nudix family protein; hydrolase, protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.55A {Bacillus thuringiensis str} Length = 171 Back     alignment and structure
>3hhj_A Mutator MUTT protein; niaid, ssgcid, decode, UW, SBRI, infectious diseases, hydrol structural genomics; 2.10A {Bartonella henselae} Length = 158 Back     alignment and structure
>2jvb_A Protein PSU1, mRNA-decapping enzyme subunit 2; DCP2, mRNA decay, cytoplasm, hydrolase, manganese, metal-binding, mRNA processing; NMR {Saccharomyces cerevisiae} Length = 146 Back     alignment and structure
>3grn_A MUTT related protein; structural genomics, hydrolase, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 1.70A {Methanosarcina mazei} Length = 153 Back     alignment and structure
>3r03_A Nudix hydrolase; structural genomics, PSI2, protein structure INIT NEW YORK SGX research center for structural genomics, nysgx; HET: ADP; 2.49A {Rhodospirillum rubrum} Length = 144 Back     alignment and structure
>1k2e_A Nudix homolog; nudix/MUTT-like fold, mixed alpha/beta, dimer, putative NUDI hydrolase, structural genomics, unknown function; 1.80A {Pyrobaculum aerophilum} SCOP: d.113.1.1 PDB: 1jrk_A 1k26_A Length = 156 Back     alignment and structure
>3gwy_A Putative CTP pyrophosphohydrolase; structural genomics, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Bacteroides fragilis} Length = 140 Back     alignment and structure
>4dyw_A MUTT/nudix family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Burkholderia pseudomallei} Length = 157 Back     alignment and structure
>1vcd_A NDX1; nudix protein, diadenosine polyphosphate, AP6A, thermus THER HB8, hydrolase, riken structural genomics/proteomics initia RSGI; 1.70A {Thermus thermophilus} SCOP: d.113.1.1 PDB: 1vc8_A 1vc9_A* Length = 126 Back     alignment and structure
>2rrk_A ORF135, CTP pyrophosphohydrolase; NMR {Escherichia coli} Length = 140 Back     alignment and structure
>1sjy_A MUTT/nudix family protein; nudix fold, alpha-beta-alpha sandwich, structural genomics, BSGC structure funded by NIH; 1.39A {Deinococcus radiodurans} SCOP: d.113.1.1 PDB: 1soi_A 1su2_A* 1sz3_A* Length = 159 Back     alignment and structure
>3ees_A Probable pyrophosphohydrolase; nudix, RNA pyrophosphohydrolase; 1.90A {Bdellovibrio bacteriovorus} PDB: 3eeu_A 3ef5_A* 3ffu_A* Length = 153 Back     alignment and structure
>2pqv_A MUTT/nudix family protein; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 1.63A {Streptococcus pneumoniae} Length = 154 Back     alignment and structure
>3gg6_A Nudix motif 18, nucleoside diphosphate-linked moiety X motif 18; NUDT18, NXR1, nucleotide hydrolase, hydrolase, structural genomics; 2.10A {Homo sapiens} Length = 156 Back     alignment and structure
>3f13_A Putative nudix hydrolase family member; structural genomics, PSI-2, protein structure initiative; 1.70A {Chromobacterium violaceum} Length = 163 Back     alignment and structure
>2b0v_A Nudix hydrolase; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG, U function; 1.55A {Nitrosomonas europaea} SCOP: d.113.1.1 Length = 153 Back     alignment and structure
>3q1p_A Phosphohydrolase (MUTT/nudix family protein); asymmetric dimer, RNA exonuclease, CDP-CHO pyrophosphatase; 1.80A {Bacillus cereus} PDB: 3q4i_A Length = 205 Back     alignment and structure
>1mut_A MUTT, nucleoside triphosphate pyrophosphohydrolase; DNA repair; NMR {Escherichia coli} SCOP: d.113.1.1 PDB: 1ppx_A* 1pun_A* 1puq_A* 1pus_A* 1tum_A* 3a6s_A* 3a6t_A* 3a6u_A* 3a6v_A* Length = 129 Back     alignment and structure
>3q93_A 7,8-dihydro-8-oxoguanine triphosphatase; structural genomics, structural genomics consortium, SGC, NU MUTT-like, hydrolase, magnesium binding; 1.80A {Homo sapiens} PDB: 1iry_A 3zr0_A* 3zr1_A Length = 176 Back     alignment and structure
>3cng_A Nudix hydrolase; structural genomics, APC7497, PSI-2, protei structure initiative; 2.00A {Nitrosomonas europaea atcc 19718} Length = 189 Back     alignment and structure
>1v8y_A ADP-ribose pyrophosphatase; nudix motif, loop-helix-loop, MUTT family, riken structural genomics/proteomics initiative, RSGI; HET: APR; 1.65A {Thermus thermophilus} SCOP: d.113.1.1 PDB: 1v8v_A* 1v8n_A 1v8l_A* 1v8m_A* 1v8i_A 1v8r_A* 1v8s_A* 1v8t_A* 1v8w_A 1v8u_A Length = 170 Back     alignment and structure
>2w4e_A MUTT/nudix family protein; ADP-ribose pyrophosphatase, hydrolase; 2.00A {Deinococcus radiodurans} Length = 145 Back     alignment and structure
>2yyh_A MUTT domain, 8-OXO-DGTPase domain; nudix family protein, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.80A {Aquifex aeolicus} Length = 139 Back     alignment and structure
>3o8s_A Nudix hydrolase, ADP-ribose pyrophosphatase; structural genomics, joint center for structural genomics, J protein structure initiative; 2.27A {Streptococcus suis} Length = 206 Back     alignment and structure
>3fk9_A Mutator MUTT protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.50A {Bacillus halodurans} Length = 188 Back     alignment and structure
>3fjy_A Probable MUTT1 protein; dimer, protein structure initiative II), NYSGXRC, 11181H, structural genomics; 2.15A {Bifidobacterium adolescentis atcc 1570ORGANISM_TAXID} Length = 364 Back     alignment and structure
>2qjt_B Nicotinamide-nucleotide adenylyltransferase; two individual domains, hydrolase; HET: AMP; 2.30A {Francisella tularensis} PDB: 2r5w_B Length = 352 Back     alignment and structure
>1vhz_A ADP compounds hydrolase NUDE; structural genomics; HET: APR; 2.32A {Escherichia coli} SCOP: d.113.1.1 PDB: 1vhg_A* Length = 198 Back     alignment and structure
>2yvp_A NDX2, MUTT/nudix family protein; nudix protein, ADP-ribose, FAD, hydrol structural genomics, NPPSFA; HET: RBY; 1.66A {Thermus thermophilus} PDB: 2yvn_A 2yvm_A* 2yvo_A* Length = 182 Back     alignment and structure
>3f6a_A Hydrolase, nudix family; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.02A {Clostridium perfringens atcc 13124} Length = 159 Back     alignment and structure
>2dsc_A ADP-sugar pyrophosphatase; nudix domain, ADPR, ADP-ribose pyrophosphatase, NUDT5, hydrolase; HET: APR; 2.00A {Homo sapiens} PDB: 2dsd_A* 3bm4_A* 2dsb_A 3aca_A* 3ac9_A* 3l85_A* Length = 212 Back     alignment and structure
>3exq_A Nudix family hydrolase; protein structure initiative II(PSI II), NYSGXRC, 11180K, structural genomics; 2.00A {Lactobacillus brevis atcc 367} Length = 161 Back     alignment and structure
>2b06_A MUTT/nudix family protein; structural genomics, P protein structure initiative, midwest center for structural genomics, MCSG; 1.40A {Streptococcus pneumoniae} SCOP: d.113.1.1 Length = 155 Back     alignment and structure
>1mk1_A ADPR pyrophosphatase; nudix hydrolase, adprase, adenosine DI ribose, RV1700, hydrolase; HET: APR; 2.00A {Mycobacterium tuberculosis} SCOP: d.113.1.1 PDB: 1mp2_A 1mqe_A* 1mqw_A* 1mr2_A* Length = 207 Back     alignment and structure
>3i9x_A MUTT/nudix family protein; structural genomics, hydrolase, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 2.20A {Listeria innocua} Length = 187 Back     alignment and structure
>3fcm_A Hydrolase, nudix family; protein structure initiative II(PSI II), NYSGXRC, 11180J, structural genomics; 2.20A {Clostridium perfringens atcc 13124} Length = 197 Back     alignment and structure
>1q27_A Putative nudix hydrolase DR0079; radiation resistance; NMR {Deinococcus radiodurans} SCOP: d.113.1.2 PDB: 2o5f_A Length = 171 Back     alignment and structure
>2fkb_A Putative nudix hydrolase YFCD; putative protein, MAD, structural genomics, escherichia coli putative nudix hydrolase, PSI; HET: MSE; 2.00A {Escherichia coli K12} SCOP: d.113.1.2 Length = 180 Back     alignment and structure
>2fml_A MUTT/nudix family protein; structural genomics, PSI, protein structure initiative, midwest center structural genomics, MCSG; 2.26A {Enterococcus faecalis} SCOP: a.4.5.68 d.113.1.6 Length = 273 Back     alignment and structure
>2qjo_A Bifunctional NMN adenylyltransferase/nudix hydrol; two individual domains, hydrolase; HET: APR NAD; 2.60A {Synechocystis SP} Length = 341 Back     alignment and structure
>1g0s_A Hypothetical 23.7 kDa protein in ICC-TOLC intergenic region; nudix fold, hydrolase; 1.90A {Escherichia coli} SCOP: d.113.1.1 PDB: 1g9q_A* 1ga7_A 1khz_A* 1viq_A Length = 209 Back     alignment and structure
>1hzt_A Isopentenyl diphosphate delta-isomerase; dimethylallyl, isoprenoids; 1.45A {Escherichia coli} SCOP: d.113.1.2 PDB: 1hx3_A 1r67_A 1x84_A* 1x83_A* 1ppv_A* 1nfz_A* 1nfs_A* 1ppw_A* 1pvf_A 2veh_A* 2vej_A 2vnp_A* 2vnq_A 2g74_A 2g73_A* 2b2k_A 1i9a_A 1q54_A* 1ow2_A* 3hyq_A* Length = 190 Back     alignment and structure
>2fb1_A Conserved hypothetical protein; structural genomics, PSI, protein STRU initiative, midwest center for structural genomics, MCSG; 2.50A {Bacteroides thetaiotaomicron} SCOP: a.4.5.68 d.113.1.6 Length = 226 Back     alignment and structure
>3o6z_A GDP-mannose pyrophosphatase NUDK; nudix, hydrolase, biofilm; 2.05A {Escherichia coli} PDB: 3o52_A* 1viu_A 3o69_A 3o61_A Length = 191 Back     alignment and structure
>1q33_A Pyrophosphatase, ADP-ribose pyrophosphatase; nudix fold, hydrolase; HET: BGC; 1.81A {Homo sapiens} SCOP: d.113.1.1 PDB: 1qvj_A* Length = 292 Back     alignment and structure
>1nqz_A COA pyrophosphatase (MUTT/nudix family protein); D.radiodurans, hydrolase; 1.70A {Deinococcus radiodurans} SCOP: d.113.1.1 PDB: 1nqy_A Length = 194 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query129
1f3y_A165 Diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase 99.9
3i7u_A134 AP4A hydrolase; nudix protein, diadenosine polypho 99.89
3u53_A155 BIS(5'-nucleosyl)-tetraphosphatase [asymmetrical]; 99.87
2kdv_A164 RNA pyrophosphohydrolase; nudix family, magnesium, 99.84
2o1c_A150 DATP pyrophosphohydrolase; nudix NTP hydrolase NTP 99.84
3r03_A144 Nudix hydrolase; structural genomics, PSI2, protei 99.83
3grn_A153 MUTT related protein; structural genomics, hydrola 99.83
3gg6_A156 Nudix motif 18, nucleoside diphosphate-linked moie 99.83
3gwy_A140 Putative CTP pyrophosphohydrolase; structural geno 99.83
2pbt_A134 AP4A hydrolase; nudix protein, diadenosine polypho 99.83
3q93_A176 7,8-dihydro-8-oxoguanine triphosphatase; structura 99.83
1ktg_A138 Diadenosine tetraphosphate hydrolase; nudix, AMP, 99.83
4dyw_A157 MUTT/nudix family protein; structural genomics, ni 99.83
3f6a_A159 Hydrolase, nudix family; protein structure initiat 99.82
1k2e_A156 Nudix homolog; nudix/MUTT-like fold, mixed alpha/b 99.82
2yyh_A139 MUTT domain, 8-OXO-DGTPase domain; nudix family pr 99.82
3id9_A171 MUTT/nudix family protein; hydrolase, protein stru 99.82
3exq_A161 Nudix family hydrolase; protein structure initiati 99.81
3eds_A153 MUTT/nudix family protein; MUT/nudix protein, prot 99.81
1sjy_A159 MUTT/nudix family protein; nudix fold, alpha-beta- 99.81
1vcd_A126 NDX1; nudix protein, diadenosine polyphosphate, AP 99.81
3son_A149 Hypothetical nudix hydrolase; structural genomics, 99.81
3oga_A165 Nucleoside triphosphatase NUDI; salmonella enteric 99.81
3hhj_A158 Mutator MUTT protein; niaid, ssgcid, decode, UW, S 99.81
3fcm_A197 Hydrolase, nudix family; protein structure initiat 99.8
1rya_A160 GDP-mannose mannosyl hydrolase; GDP-glucose, nudix 99.8
3q1p_A205 Phosphohydrolase (MUTT/nudix family protein); asym 99.79
2b0v_A153 Nudix hydrolase; structural genomics, PSI, protein 99.79
2w4e_A145 MUTT/nudix family protein; ADP-ribose pyrophosphat 99.79
2azw_A148 MUTT/nudix family protein; MUTT/nudix ,enterococcu 99.79
3fk9_A188 Mutator MUTT protein; structural genomics, hydrola 99.79
1hzt_A190 Isopentenyl diphosphate delta-isomerase; dimethyla 99.79
2jvb_A146 Protein PSU1, mRNA-decapping enzyme subunit 2; DCP 99.79
3ees_A153 Probable pyrophosphohydrolase; nudix, RNA pyrophos 99.79
2pqv_A154 MUTT/nudix family protein; structu genomics, PSI-2 99.78
2rrk_A140 ORF135, CTP pyrophosphohydrolase; NMR {Escherichia 99.78
2fkb_A180 Putative nudix hydrolase YFCD; putative protein, M 99.78
2fvv_A194 Diphosphoinositol polyphosphate phosphohydrolase 1 99.78
3shd_A153 Phosphatase NUDJ; nudix fold, nudix motif, hydrola 99.77
3f13_A163 Putative nudix hydrolase family member; structural 99.77
3cng_A189 Nudix hydrolase; structural genomics, APC7497, PSI 99.77
1nqz_A194 COA pyrophosphatase (MUTT/nudix family protein); D 99.77
3h95_A199 Nucleoside diphosphate-linked moiety X motif 6; NU 99.76
3o8s_A206 Nudix hydrolase, ADP-ribose pyrophosphatase; struc 99.76
2b06_A155 MUTT/nudix family protein; structural genomics, P 99.75
3i9x_A187 MUTT/nudix family protein; structural genomics, hy 99.75
1v8y_A170 ADP-ribose pyrophosphatase; nudix motif, loop-heli 99.75
2yvp_A182 NDX2, MUTT/nudix family protein; nudix protein, AD 99.75
1mut_A129 MUTT, nucleoside triphosphate pyrophosphohydrolase 99.75
2a6t_A271 SPAC19A8.12; alpha/beta/alpha, RNA binding protein 99.75
1vhz_A198 ADP compounds hydrolase NUDE; structural genomics; 99.74
2fb1_A226 Conserved hypothetical protein; structural genomic 99.73
1q27_A171 Putative nudix hydrolase DR0079; radiation resista 99.73
1vk6_A269 NADH pyrophosphatase; 1790429, structural genomics 99.72
3o6z_A191 GDP-mannose pyrophosphatase NUDK; nudix, hydrolase 99.72
3e57_A211 Uncharacterized protein TM1382; structural genomic 99.72
3gz5_A240 MUTT/nudix family protein; DNA binding protein, nu 99.72
1mk1_A207 ADPR pyrophosphatase; nudix hydrolase, adprase, ad 99.71
2qjo_A341 Bifunctional NMN adenylyltransferase/nudix hydrol; 99.7
2qjt_B352 Nicotinamide-nucleotide adenylyltransferase; two i 99.7
1g0s_A209 Hypothetical 23.7 kDa protein in ICC-TOLC intergen 99.68
3q91_A218 Uridine diphosphate glucose pyrophosphatase; struc 99.68
3fjy_A 364 Probable MUTT1 protein; dimer, protein structure i 99.66
1x51_A155 A/G-specific adenine DNA glycosylase; nudix domain 99.65
2dsc_A212 ADP-sugar pyrophosphatase; nudix domain, ADPR, ADP 99.65
2fml_A 273 MUTT/nudix family protein; structural genomics, PS 99.64
3fsp_A369 A/G-specific adenine glycosylase; protein-DNA comp 99.63
1u20_A212 U8 snoRNA-binding protein X29; modified nudix hydr 99.63
2dho_A235 Isopentenyl-diphosphate delta-isomerase 1; alpha/b 99.61
2pny_A246 Isopentenyl-diphosphate delta-isomerase 2; caroten 99.6
3qsj_A232 Nudix hydrolase; structural genomics, PSI-biology, 99.51
3dup_A300 MUTT/nudix family protein; nudix superfamily hydro 99.49
1q33_A292 Pyrophosphatase, ADP-ribose pyrophosphatase; nudix 99.46
2xsq_A217 U8 snoRNA-decapping enzyme; hydrolase, mRNA decapp 99.4
3bho_A208 Cleavage and polyadenylation specificity factor su 99.34
3kvh_A214 Protein syndesmos; NUDT16-like, NUDT16L1, nudix, R 99.33
3rh7_A321 Hypothetical oxidoreductase; FMN-binding split bar 99.21
>1f3y_A Diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase; enzyme,mixed 4-stranded beta sheet, 2-stranded antiparallel sheet; NMR {Lupinus angustifolius} SCOP: d.113.1.1 PDB: 1jkn_A* Back     alignment and structure
Probab=99.90  E-value=2.2e-24  Score=145.85  Aligned_cols=80  Identities=73%  Similarity=1.321  Sum_probs=65.5

Q ss_pred             CCCCCCCCcCEEEEEEEeCCCcEEEEEEcCCCCcEEcCeeecCCCCCHHHHHHHHHHHHhCCceeeEEeecCceEEeecC
Q 033022            1 MDGLPSGYRPNVGVCLINSDSQIFVASRLNVPGAWQMPQGGIEDGEDPKLAAMRELREETGIVSAEIIAEVPNWLTYDFP   80 (129)
Q Consensus         1 m~~~~~~~~~~~~~~i~~~~~~vLl~~r~~~~g~w~~PgG~ve~gEs~~~aa~RE~~EEtGl~~~~~~~~~~~~~~~~~~   80 (129)
                      |...+..+|.++++++++.++++||++|...+|.|++|||++++|||+++||+||++||||+.+..+......+..+.++
T Consensus         6 ~~~~~~~~~~~v~~~i~~~~~~vLl~~r~~~~g~w~~PgG~ve~gE~~~~aa~RE~~EEtGl~~~~~~~~~~~~~~~~~~   85 (165)
T 1f3y_A            6 MDSPPEGYRRNVGICLMNNDKKIFAASRLDIPDAWQMPQGGIDEGEDPRNAAIRELREETGVTSAEVIAEVPYWLTYDFP   85 (165)
T ss_dssp             CSSCCSSCCCEEEEEEECTTSCEEEEEETTEEEEEECCEEECCTTCCHHHHHHHHHHHHHCCCSEEEEEECSSCCBCCCC
T ss_pred             ccCCccceeeeEEEEEECCCCcEEEEecCCCCCcEECCeeccCCCCCHHHHHHHHHHHhhCCChhhhhcccccceeeecC
Confidence            44556668999999999999999999998767999999999999999999999999999999975554443333344443



>3i7u_A AP4A hydrolase; nudix protein, diadenosine polyphosphate, S genomics, NPPSFA, national project on protein structural AN functional analyses; HET: PGE PG4; 1.80A {Aquifex aeolicus} PDB: 3i7v_A* Back     alignment and structure
>3u53_A BIS(5'-nucleosyl)-tetraphosphatase [asymmetrical]; hydrolase; 2.71A {Homo sapiens} PDB: 1xsa_A 1xsb_A 1xsc_A* Back     alignment and structure
>2kdv_A RNA pyrophosphohydrolase; nudix family, magnesium, manganese, zinc; NMR {Escherichia coli} PDB: 2kdw_A Back     alignment and structure
>2o1c_A DATP pyrophosphohydrolase; nudix NTP hydrolase NTP pyrophosphohydrolase MUTT dihydroneo triphosphate pyrophosphohydrolase folate biosynthesis; 1.80A {Escherichia coli} PDB: 2o5w_A Back     alignment and structure
>3r03_A Nudix hydrolase; structural genomics, PSI2, protein structure INIT NEW YORK SGX research center for structural genomics, nysgx; HET: ADP; 2.49A {Rhodospirillum rubrum} SCOP: d.113.1.0 Back     alignment and structure
>3grn_A MUTT related protein; structural genomics, hydrolase, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 1.70A {Methanosarcina mazei} Back     alignment and structure
>3gg6_A Nudix motif 18, nucleoside diphosphate-linked moiety X motif 18; NUDT18, NXR1, nucleotide hydrolase, hydrolase, structural genomics; 2.10A {Homo sapiens} Back     alignment and structure
>3gwy_A Putative CTP pyrophosphohydrolase; structural genomics, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Bacteroides fragilis} SCOP: d.113.1.0 Back     alignment and structure
>3q93_A 7,8-dihydro-8-oxoguanine triphosphatase; structural genomics, structural genomics consortium, SGC, NU MUTT-like, hydrolase, magnesium binding; 1.80A {Homo sapiens} PDB: 1iry_A 3zr0_A* 3zr1_A Back     alignment and structure
>1ktg_A Diadenosine tetraphosphate hydrolase; nudix, AMP, magnesium cluster; HET: AMP; 1.80A {Caenorhabditis elegans} SCOP: d.113.1.1 PDB: 1kt9_A* Back     alignment and structure
>4dyw_A MUTT/nudix family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Burkholderia pseudomallei} Back     alignment and structure
>3f6a_A Hydrolase, nudix family; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.02A {Clostridium perfringens atcc 13124} Back     alignment and structure
>1k2e_A Nudix homolog; nudix/MUTT-like fold, mixed alpha/beta, dimer, putative NUDI hydrolase, structural genomics, unknown function; 1.80A {Pyrobaculum aerophilum} SCOP: d.113.1.1 PDB: 1jrk_A 1k26_A Back     alignment and structure
>2yyh_A MUTT domain, 8-OXO-DGTPase domain; nudix family protein, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.80A {Aquifex aeolicus} Back     alignment and structure
>3id9_A MUTT/nudix family protein; hydrolase, protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.55A {Bacillus thuringiensis str} Back     alignment and structure
>3exq_A Nudix family hydrolase; protein structure initiative II(PSI II), NYSGXRC, 11180K, structural genomics; 2.00A {Lactobacillus brevis atcc 367} Back     alignment and structure
>1sjy_A MUTT/nudix family protein; nudix fold, alpha-beta-alpha sandwich, structural genomics, BSGC structure funded by NIH; 1.39A {Deinococcus radiodurans} SCOP: d.113.1.1 PDB: 1soi_A 1su2_A* 1sz3_A* Back     alignment and structure
>1vcd_A NDX1; nudix protein, diadenosine polyphosphate, AP6A, thermus THER HB8, hydrolase, riken structural genomics/proteomics initia RSGI; 1.70A {Thermus thermophilus} SCOP: d.113.1.1 PDB: 1vc8_A 1vc9_A* Back     alignment and structure
>3son_A Hypothetical nudix hydrolase; structural genomics, joint center for structural GENO JCSG, protein structure initiative, PSI-biology; HET: MSE; 1.71A {Listeria monocytogenes} Back     alignment and structure
>3oga_A Nucleoside triphosphatase NUDI; salmonella enterica subsp. enterica serovar typhimurium STR. unknown function; HET: PO4; 1.75A {Salmonella enterica subsp} PDB: 3n77_A Back     alignment and structure
>3hhj_A Mutator MUTT protein; niaid, ssgcid, decode, UW, SBRI, infectious diseases, hydrol structural genomics; 2.10A {Bartonella henselae} Back     alignment and structure
>3fcm_A Hydrolase, nudix family; protein structure initiative II(PSI II), NYSGXRC, 11180J, structural genomics; 2.20A {Clostridium perfringens atcc 13124} Back     alignment and structure
>1rya_A GDP-mannose mannosyl hydrolase; GDP-glucose, nudix, nudix Mg-complex; HET: GDP; 1.30A {Escherichia coli} SCOP: d.113.1.5 PDB: 2gt2_A 2gt4_A* 2i8t_A* 2i8u_A* Back     alignment and structure
>3q1p_A Phosphohydrolase (MUTT/nudix family protein); asymmetric dimer, RNA exonuclease, CDP-CHO pyrophosphatase; 1.80A {Bacillus cereus} PDB: 3q4i_A Back     alignment and structure
>2b0v_A Nudix hydrolase; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG, U function; 1.55A {Nitrosomonas europaea} SCOP: d.113.1.1 Back     alignment and structure
>2w4e_A MUTT/nudix family protein; ADP-ribose pyrophosphatase, hydrolase; 2.00A {Deinococcus radiodurans} Back     alignment and structure
>2azw_A MUTT/nudix family protein; MUTT/nudix ,enterococcus faecalis, structural genomics, PSI, structure initiative; HET: 1PE; 1.90A {Enterococcus faecalis} SCOP: d.113.1.1 Back     alignment and structure
>3fk9_A Mutator MUTT protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.50A {Bacillus halodurans} Back     alignment and structure
>1hzt_A Isopentenyl diphosphate delta-isomerase; dimethylallyl, isoprenoids; 1.45A {Escherichia coli} SCOP: d.113.1.2 PDB: 1hx3_A 1r67_A 1x84_A* 1x83_A* 1ppv_A* 1nfz_A* 1nfs_A* 1ppw_A* 1pvf_A 2veh_A* 2vej_A 2vnp_A* 2vnq_A 2g74_A 2g73_A* 2b2k_A 1i9a_A 1q54_A* 1ow2_A* 3hyq_A* Back     alignment and structure
>2jvb_A Protein PSU1, mRNA-decapping enzyme subunit 2; DCP2, mRNA decay, cytoplasm, hydrolase, manganese, metal-binding, mRNA processing; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3ees_A Probable pyrophosphohydrolase; nudix, RNA pyrophosphohydrolase; 1.90A {Bdellovibrio bacteriovorus} PDB: 3eeu_A 3ef5_A* 3ffu_A* Back     alignment and structure
>2pqv_A MUTT/nudix family protein; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 1.63A {Streptococcus pneumoniae} Back     alignment and structure
>2rrk_A ORF135, CTP pyrophosphohydrolase; NMR {Escherichia coli} Back     alignment and structure
>2fkb_A Putative nudix hydrolase YFCD; putative protein, MAD, structural genomics, escherichia coli putative nudix hydrolase, PSI; HET: MSE; 2.00A {Escherichia coli K12} SCOP: d.113.1.2 Back     alignment and structure
>2fvv_A Diphosphoinositol polyphosphate phosphohydrolase 1; nudix, inositol polyphosphate metabolism, structural genomics, structural genomics consortium; HET: IHP; 1.25A {Homo sapiens} SCOP: d.113.1.1 PDB: 2q9p_A* 2duk_A 3mcf_A* Back     alignment and structure
>3shd_A Phosphatase NUDJ; nudix fold, nudix motif, hydrolase, (D)NDP/(D)NTP binding, dephosphorylation; 2.50A {Escherichia coli} PDB: 3dku_A Back     alignment and structure
>3f13_A Putative nudix hydrolase family member; structural genomics, PSI-2, protein structure initiative; 1.70A {Chromobacterium violaceum} Back     alignment and structure
>3cng_A Nudix hydrolase; structural genomics, APC7497, PSI-2, protei structure initiative; 2.00A {Nitrosomonas europaea atcc 19718} Back     alignment and structure
>1nqz_A COA pyrophosphatase (MUTT/nudix family protein); D.radiodurans, hydrolase; 1.70A {Deinococcus radiodurans} SCOP: d.113.1.1 PDB: 1nqy_A Back     alignment and structure
>3h95_A Nucleoside diphosphate-linked moiety X motif 6; NUDT6, nudix, hydrolase, GFG, GFG-1, FGF2AS, structural GENO structural genomics consortium, SGC; HET: FLC; 1.70A {Homo sapiens} Back     alignment and structure
>3o8s_A Nudix hydrolase, ADP-ribose pyrophosphatase; structural genomics, joint center for structural genomics, J protein structure initiative; 2.27A {Streptococcus suis} Back     alignment and structure
>2b06_A MUTT/nudix family protein; structural genomics, P protein structure initiative, midwest center for structural genomics, MCSG; 1.40A {Streptococcus pneumoniae} SCOP: d.113.1.1 Back     alignment and structure
>3i9x_A MUTT/nudix family protein; structural genomics, hydrolase, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 2.20A {Listeria innocua} Back     alignment and structure
>1v8y_A ADP-ribose pyrophosphatase; nudix motif, loop-helix-loop, MUTT family, riken structural genomics/proteomics initiative, RSGI; HET: APR; 1.65A {Thermus thermophilus} SCOP: d.113.1.1 PDB: 1v8v_A* 1v8n_A 1v8l_A* 1v8m_A* 1v8i_A 1v8r_A* 1v8s_A* 1v8t_A* 1v8w_A 1v8u_A Back     alignment and structure
>2yvp_A NDX2, MUTT/nudix family protein; nudix protein, ADP-ribose, FAD, hydrol structural genomics, NPPSFA; HET: RBY; 1.66A {Thermus thermophilus} PDB: 2yvn_A 2yvm_A* 2yvo_A* Back     alignment and structure
>1mut_A MUTT, nucleoside triphosphate pyrophosphohydrolase; DNA repair; NMR {Escherichia coli} SCOP: d.113.1.1 PDB: 1ppx_A* 1pun_A* 1puq_A* 1pus_A* 1tum_A* 3a6s_A* 3a6t_A* 3a6u_A* 3a6v_A* Back     alignment and structure
>2a6t_A SPAC19A8.12; alpha/beta/alpha, RNA binding protein,hydrolase; 2.50A {Schizosaccharomyces pombe} SCOP: a.242.1.1 d.113.1.7 PDB: 2qkm_B* Back     alignment and structure
>1vhz_A ADP compounds hydrolase NUDE; structural genomics; HET: APR; 2.32A {Escherichia coli} SCOP: d.113.1.1 PDB: 1vhg_A* Back     alignment and structure
>2fb1_A Conserved hypothetical protein; structural genomics, PSI, protein STRU initiative, midwest center for structural genomics, MCSG; 2.50A {Bacteroides thetaiotaomicron} SCOP: a.4.5.68 d.113.1.6 Back     alignment and structure
>1q27_A Putative nudix hydrolase DR0079; radiation resistance; NMR {Deinococcus radiodurans} SCOP: d.113.1.2 PDB: 2o5f_A Back     alignment and structure
>1vk6_A NADH pyrophosphatase; 1790429, structural genomics, JCSG, PS protein structure initiative, joint center for structural G hydrolase; HET: MSE; 2.20A {Escherichia coli} SCOP: d.113.1.4 d.113.1.4 g.41.14.1 PDB: 2gb5_A Back     alignment and structure
>3o6z_A GDP-mannose pyrophosphatase NUDK; nudix, hydrolase, biofilm; 2.05A {Escherichia coli} SCOP: d.113.1.1 PDB: 3o52_A* 1viu_A 3o69_A 3o61_A Back     alignment and structure
>3e57_A Uncharacterized protein TM1382; structural genomics, nudix hydrolase, PSI-2, protein structure initiative; 1.89A {Thermotoga maritima} Back     alignment and structure
>3gz5_A MUTT/nudix family protein; DNA binding protein, nudix domain, WHTH domain; 2.20A {Shewanella oneidensis} PDB: 3gz6_A* 3gz8_A* Back     alignment and structure
>1mk1_A ADPR pyrophosphatase; nudix hydrolase, adprase, adenosine DI ribose, RV1700, hydrolase; HET: APR; 2.00A {Mycobacterium tuberculosis} SCOP: d.113.1.1 PDB: 1mp2_A 1mqe_A* 1mqw_A* 1mr2_A* Back     alignment and structure
>2qjo_A Bifunctional NMN adenylyltransferase/nudix hydrol; two individual domains, hydrolase; HET: APR NAD; 2.60A {Synechocystis SP} Back     alignment and structure
>2qjt_B Nicotinamide-nucleotide adenylyltransferase; two individual domains, hydrolase; HET: AMP; 2.30A {Francisella tularensis} PDB: 2r5w_B Back     alignment and structure
>1g0s_A Hypothetical 23.7 kDa protein in ICC-TOLC intergenic region; nudix fold, hydrolase; 1.90A {Escherichia coli} SCOP: d.113.1.1 PDB: 1g9q_A* 1ga7_A 1khz_A* 1viq_A Back     alignment and structure
>3q91_A Uridine diphosphate glucose pyrophosphatase; structural genomics, structural genomics consortium, SGC, NU MUTT-like, hydrolase, magnesium binding; 2.70A {Homo sapiens} Back     alignment and structure
>3fjy_A Probable MUTT1 protein; dimer, protein structure initiative II), NYSGXRC, 11181H, structural genomics; 2.15A {Bifidobacterium adolescentis atcc 1570ORGANISM_TAXID} Back     alignment and structure
>1x51_A A/G-specific adenine DNA glycosylase; nudix domain, DNA repair, alpha-3 isoform, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.113.1.3 Back     alignment and structure
>2dsc_A ADP-sugar pyrophosphatase; nudix domain, ADPR, ADP-ribose pyrophosphatase, NUDT5, hydrolase; HET: APR; 2.00A {Homo sapiens} PDB: 2dsd_A* 3bm4_A* 2dsb_A 3aca_A* 3ac9_A* 3l85_A* Back     alignment and structure
>2fml_A MUTT/nudix family protein; structural genomics, PSI, protein structure initiative, midwest center structural genomics, MCSG; 2.26A {Enterococcus faecalis} SCOP: a.4.5.68 d.113.1.6 Back     alignment and structure
>3fsp_A A/G-specific adenine glycosylase; protein-DNA complex, DNA glycosylase, transition state analog, DNA repair; HET: NRI; 2.20A {Geobacillus stearothermophilus} PDB: 3fsq_A* 1rrs_A* 1vrl_A* 1rrq_A* 3g0q_A* Back     alignment and structure
>1u20_A U8 snoRNA-binding protein X29; modified nudix hydrolase fold, hydrolase; 2.10A {Xenopus laevis} SCOP: d.113.1.1 PDB: 2a8t_A* 2a8q_A* 2a8p_A* 2a8r_A* 2a8s_A* Back     alignment and structure
>2dho_A Isopentenyl-diphosphate delta-isomerase 1; alpha/beta protein; 1.60A {Homo sapiens} PDB: 2i6k_A* 2icj_A 2ick_A* Back     alignment and structure
>2pny_A Isopentenyl-diphosphate delta-isomerase 2; carotenoid biosynthesis, cholesterol biosynthesis, isomerase isoprene biosynthesis, lipid synthesis; HET: GOL; 1.81A {Homo sapiens} Back     alignment and structure
>3qsj_A Nudix hydrolase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 1.70A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3dup_A MUTT/nudix family protein; nudix superfamily hydrolase, hydrolase 3 family, structural protein structure initiative, PSI; HET: MSE; 1.80A {Rhodospirillum rubrum atcc 11170} Back     alignment and structure
>1q33_A Pyrophosphatase, ADP-ribose pyrophosphatase; nudix fold, hydrolase; HET: BGC; 1.81A {Homo sapiens} SCOP: d.113.1.1 PDB: 1qvj_A* Back     alignment and structure
>2xsq_A U8 snoRNA-decapping enzyme; hydrolase, mRNA decapping, mRNA turnover, structural genomic consortium, SGC; HET: IMP; 1.72A {Homo sapiens} PDB: 3cou_A 3mgm_A Back     alignment and structure
>3bho_A Cleavage and polyadenylation specificity factor subunit 5; CPSF5, RNA processing, cleavage factor, diadenosine tetraphosphate, mRNA processing; HET: B4P; 1.80A {Homo sapiens} PDB: 3bap_A 3mdg_A 3mdi_A 2cl3_A 3n9u_A 3q2s_A 3q2t_A 2j8q_A 3p5t_A 3p6y_A Back     alignment and structure
>3kvh_A Protein syndesmos; NUDT16-like, NUDT16L1, nudix, RNA regulation, RNA structural genomics consortium, SGC, RNA degradation, RNA B protein; 1.70A {Homo sapiens} Back     alignment and structure
>3rh7_A Hypothetical oxidoreductase; FMN-binding split barrel, nudix, structural genomics, joint for structural genomics, JCSG; HET: FMN; 3.00A {Sinorhizobium meliloti} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 129
d1jkna_165 d.113.1.1 (A:) Diadenosine tetraphosphate hydrolas 4e-25
d2a6ta2151 d.113.1.7 (A:95-245) mRNA decapping enzyme Dcp2p c 5e-11
d1xsba_153 d.113.1.1 (A:) Diadenosine tetraphosphate hydrolas 8e-11
d1irya_156 d.113.1.1 (A:) 7,8-dihydro-8-oxoguanine triphospha 4e-10
d2fvva1135 d.113.1.1 (A:8-142) Diphosphoinositol polyphosphat 5e-10
d1sjya_158 d.113.1.1 (A:) Hypothetical protein DR1025 {Deinoc 6e-10
d1ryaa_160 d.113.1.5 (A:) GDP-mannose mannosyl hydrolase NudD 4e-09
d2b0va1146 d.113.1.1 (A:4-149) Hypothetical protein NE0184 {N 1e-08
d1vcda1126 d.113.1.1 (A:1-126) AP6A hydrolase Ndx1 {Thermus t 2e-08
d1u20a1196 d.113.1.1 (A:14-209) U8 snorna-binding protein x29 2e-08
d2azwa1147 d.113.1.1 (A:2-148) Hypothetical protein EF1141 {E 2e-08
d1k2ea_152 d.113.1.1 (A:) Hypothetical protein PAE3301 {Archa 3e-08
d1q33a_292 d.113.1.1 (A:) NUDT9 (mitochondrial ADP-ribose pyr 2e-07
d1vk6a2131 d.113.1.4 (A:126-256) NADH pyrophosphatase {Escher 1e-05
d2fmla2202 d.113.1.6 (A:3-204) Hypothetical protein EF2700, N 3e-05
d1hzta_153 d.113.1.2 (A:) Isopentenyl diphosphate isomerase { 6e-05
d1nqza_187 d.113.1.1 (A:) Coenzyme A pyrophosphatase {Deinoco 2e-04
d2b06a1155 d.113.1.1 (A:1-155) Hypothetical protein SP1235 (s 4e-04
d1v8ya_158 d.113.1.1 (A:) ADP-ribose pyrophosphatase {Thermus 0.001
d1g0sa_209 d.113.1.1 (A:) ADP-ribose pyrophosphatase {Escheri 0.001
d1viua_189 d.113.1.1 (A:) ADP-ribose pyrophosphatase homologu 0.001
d1ktga_137 d.113.1.1 (A:) Diadenosine tetraphosphate hydrolas 0.002
d2o5fa1162 d.113.1.2 (A:7-168) Hypothetical protein DR0079 {D 0.003
>d1jkna_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Narrow-leaved blue lupine (Lupinus angustifolius) [TaxId: 3871]} Length = 165 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Nudix
superfamily: Nudix
family: MutT-like
domain: Diadenosine tetraphosphate hydrolase (Ap4A hydrolase)
species: Narrow-leaved blue lupine (Lupinus angustifolius) [TaxId: 3871]
 Score = 91.4 bits (226), Expect = 4e-25
 Identities = 71/104 (68%), Positives = 87/104 (83%)

Query: 1   MDGLPSGYRPNVGVCLINSDSQIFVASRLNVPGAWQMPQGGIEDGEDPKLAAMRELREET 60
           MD  P GYR NVG+CL+N+D +IF ASRL++P AWQMPQGGI++GEDP+ AA+RELREET
Sbjct: 6   MDSPPEGYRRNVGICLMNNDKKIFAASRLDIPDAWQMPQGGIDEGEDPRNAAIRELREET 65

Query: 61  GIVSAEIIAEVPNWLTYDFPPAVKTKVNRLWGGEWHGQAQKWYA 104
           G+ SAE+IAEVP WLTYDFPP V+ K+N  WG +W GQAQKW+ 
Sbjct: 66  GVTSAEVIAEVPYWLTYDFPPKVREKLNIQWGSDWKGQAQKWFL 109


>d2a6ta2 d.113.1.7 (A:95-245) mRNA decapping enzyme Dcp2p catalytic domain {Schizosaccharomyces pombe [TaxId: 4896]} Length = 151 Back     information, alignment and structure
>d1xsba_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Human (Homo sapiens) [TaxId: 9606]} Length = 153 Back     information, alignment and structure
>d1irya_ d.113.1.1 (A:) 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2fvva1 d.113.1.1 (A:8-142) Diphosphoinositol polyphosphate phosphohydrolase {Human (Homo sapiens) [TaxId: 9606]} Length = 135 Back     information, alignment and structure
>d1sjya_ d.113.1.1 (A:) Hypothetical protein DR1025 {Deinococcus radiodurans [TaxId: 1299]} Length = 158 Back     information, alignment and structure
>d1ryaa_ d.113.1.5 (A:) GDP-mannose mannosyl hydrolase NudD {Escherichia coli [TaxId: 562]} Length = 160 Back     information, alignment and structure
>d2b0va1 d.113.1.1 (A:4-149) Hypothetical protein NE0184 {Nitrosomonas europaea [TaxId: 915]} Length = 146 Back     information, alignment and structure
>d1vcda1 d.113.1.1 (A:1-126) AP6A hydrolase Ndx1 {Thermus thermophilus [TaxId: 274]} Length = 126 Back     information, alignment and structure
>d1u20a1 d.113.1.1 (A:14-209) U8 snorna-binding protein x29 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 196 Back     information, alignment and structure
>d2azwa1 d.113.1.1 (A:2-148) Hypothetical protein EF1141 {Enterococcus faecalis [TaxId: 1351]} Length = 147 Back     information, alignment and structure
>d1k2ea_ d.113.1.1 (A:) Hypothetical protein PAE3301 {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 152 Back     information, alignment and structure
>d1q33a_ d.113.1.1 (A:) NUDT9 (mitochondrial ADP-ribose pyrophosphatase) {Human (Homo sapiens) [TaxId: 9606]} Length = 292 Back     information, alignment and structure
>d1vk6a2 d.113.1.4 (A:126-256) NADH pyrophosphatase {Escherichia coli [TaxId: 562]} Length = 131 Back     information, alignment and structure
>d2fmla2 d.113.1.6 (A:3-204) Hypothetical protein EF2700, N-terminal domain {Enterococcus faecalis [TaxId: 1351]} Length = 202 Back     information, alignment and structure
>d1hzta_ d.113.1.2 (A:) Isopentenyl diphosphate isomerase {Escherichia coli [TaxId: 562]} Length = 153 Back     information, alignment and structure
>d1nqza_ d.113.1.1 (A:) Coenzyme A pyrophosphatase {Deinococcus radiodurans [TaxId: 1299]} Length = 187 Back     information, alignment and structure
>d2b06a1 d.113.1.1 (A:1-155) Hypothetical protein SP1235 (spr1115) {Streptococcus pneumoniae [TaxId: 1313]} Length = 155 Back     information, alignment and structure
>d1v8ya_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Thermus thermophilus [TaxId: 274]} Length = 158 Back     information, alignment and structure
>d1g0sa_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Escherichia coli [TaxId: 562]} Length = 209 Back     information, alignment and structure
>d1viua_ d.113.1.1 (A:) ADP-ribose pyrophosphatase homologue YffH {Escherichia coli [TaxId: 562]} Length = 189 Back     information, alignment and structure
>d1ktga_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Caenorhabditis elegans [TaxId: 6239]} Length = 137 Back     information, alignment and structure
>d2o5fa1 d.113.1.2 (A:7-168) Hypothetical protein DR0079 {Deinococcus radiodurans str. R1 (Deinococcus radiodurans R1) [TaxId: 243230]} Length = 162 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query129
d1jkna_165 Diadenosine tetraphosphate hydrolase (Ap4A hydrola 99.94
d1vcda1126 AP6A hydrolase Ndx1 {Thermus thermophilus [TaxId: 99.89
d1irya_156 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Hum 99.88
d2a6ta2151 mRNA decapping enzyme Dcp2p catalytic domain {Schi 99.85
d2b0va1146 Hypothetical protein NE0184 {Nitrosomonas europaea 99.85
d1sjya_158 Hypothetical protein DR1025 {Deinococcus radiodura 99.85
d1ktga_137 Diadenosine tetraphosphate hydrolase (Ap4A hydrola 99.85
d2fvva1135 Diphosphoinositol polyphosphate phosphohydrolase { 99.85
d2b06a1155 Hypothetical protein SP1235 (spr1115) {Streptococc 99.84
d1hzta_153 Isopentenyl diphosphate isomerase {Escherichia col 99.84
d1vk6a2131 NADH pyrophosphatase {Escherichia coli [TaxId: 562 99.84
d2azwa1147 Hypothetical protein EF1141 {Enterococcus faecalis 99.83
d1k2ea_152 Hypothetical protein PAE3301 {Archaeon Pyrobaculum 99.83
d1ryaa_160 GDP-mannose mannosyl hydrolase NudD {Escherichia c 99.83
d1puna_129 Nucleoside triphosphate pyrophosphorylase (MutT) { 99.82
d2fkba1161 Hypothetical protein YfcD {Escherichia coli [TaxId 99.82
d1xsba_153 Diadenosine tetraphosphate hydrolase (Ap4A hydrola 99.82
d2fb1a2147 Hypothetical protein BT0354, N-terminal domain {Ba 99.81
d2o5fa1162 Hypothetical protein DR0079 {Deinococcus radiodura 99.79
d2fmla2202 Hypothetical protein EF2700, N-terminal domain {En 99.78
d1nqza_187 Coenzyme A pyrophosphatase {Deinococcus radioduran 99.74
d1v8ya_158 ADP-ribose pyrophosphatase {Thermus thermophilus [ 99.72
d1vhza_186 ADP compounds hydrolase NudE {Escherichia coli [Ta 99.7
d1mqea_202 ADP-ribose pyrophosphatase {Mycobacterium tubercul 99.68
d1rrqa2127 Adenine glycosylase MutY, C-terminal domain {Bacil 99.66
d1u20a1196 U8 snorna-binding protein x29 {African clawed frog 99.62
d1g0sa_209 ADP-ribose pyrophosphatase {Escherichia coli [TaxI 99.56
d1q33a_292 NUDT9 (mitochondrial ADP-ribose pyrophosphatase) { 99.35
d1viua_189 ADP-ribose pyrophosphatase homologue YffH {Escheri 99.29
d1x51a1142 A/G-specific adenine DNA glycosylase {Human (Homo 99.19
>d1jkna_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Narrow-leaved blue lupine (Lupinus angustifolius) [TaxId: 3871]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Nudix
superfamily: Nudix
family: MutT-like
domain: Diadenosine tetraphosphate hydrolase (Ap4A hydrolase)
species: Narrow-leaved blue lupine (Lupinus angustifolius) [TaxId: 3871]
Probab=99.94  E-value=4.1e-28  Score=164.66  Aligned_cols=67  Identities=69%  Similarity=1.243  Sum_probs=62.5

Q ss_pred             CCCCCCCCcCEEEEEEEeCCCcEEEEEEcCCCCcEEcCeeecCCCCCHHHHHHHHHHHHhCCceeeE
Q 033022            1 MDGLPSGYRPNVGVCLINSDSQIFVASRLNVPGAWQMPQGGIEDGEDPKLAAMRELREETGIVSAEI   67 (129)
Q Consensus         1 m~~~~~~~~~~~~~~i~~~~~~vLl~~r~~~~g~w~~PgG~ve~gEs~~~aa~RE~~EEtGl~~~~~   67 (129)
                      |+..|++||++|+++|+|.+++|||++|.+.+|.|++|||+||+|||+++||+||++||||+++..+
T Consensus         6 ~~~~~~~yR~~Vg~vI~n~~~~vLL~kR~~~~g~W~~PgG~ve~gEt~~~Aa~REl~EEtGl~~~~~   72 (165)
T d1jkna_           6 MDSPPEGYRRNVGICLMNNDKKIFAASRLDIPDAWQMPQGGIDEGEDPRNAAIRELREETGVTSAEV   72 (165)
T ss_dssp             CSSCCSSEEEEEEEEEECTTSCEEEEEESSSTTCEECCEECCCTTCCHHHHHHHHHHHHTCCCSEEE
T ss_pred             cCCCCCCccccEEEEEEeCCCEEEEEEEcCCCCcccCccceEcCCCChhHHHHHHHHHhhccccccc
Confidence            7778889999999999999999999999988899999999999999999999999999999996543



>d1vcda1 d.113.1.1 (A:1-126) AP6A hydrolase Ndx1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1irya_ d.113.1.1 (A:) 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a6ta2 d.113.1.7 (A:95-245) mRNA decapping enzyme Dcp2p catalytic domain {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d2b0va1 d.113.1.1 (A:4-149) Hypothetical protein NE0184 {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d1sjya_ d.113.1.1 (A:) Hypothetical protein DR1025 {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1ktga_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2fvva1 d.113.1.1 (A:8-142) Diphosphoinositol polyphosphate phosphohydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b06a1 d.113.1.1 (A:1-155) Hypothetical protein SP1235 (spr1115) {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1hzta_ d.113.1.2 (A:) Isopentenyl diphosphate isomerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vk6a2 d.113.1.4 (A:126-256) NADH pyrophosphatase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2azwa1 d.113.1.1 (A:2-148) Hypothetical protein EF1141 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1k2ea_ d.113.1.1 (A:) Hypothetical protein PAE3301 {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1ryaa_ d.113.1.5 (A:) GDP-mannose mannosyl hydrolase NudD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1puna_ d.113.1.1 (A:) Nucleoside triphosphate pyrophosphorylase (MutT) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fkba1 d.113.1.2 (A:8-168) Hypothetical protein YfcD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xsba_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fb1a2 d.113.1.6 (A:3-149) Hypothetical protein BT0354, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d2o5fa1 d.113.1.2 (A:7-168) Hypothetical protein DR0079 {Deinococcus radiodurans str. R1 (Deinococcus radiodurans R1) [TaxId: 243230]} Back     information, alignment and structure
>d2fmla2 d.113.1.6 (A:3-204) Hypothetical protein EF2700, N-terminal domain {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1nqza_ d.113.1.1 (A:) Coenzyme A pyrophosphatase {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1v8ya_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vhza_ d.113.1.1 (A:) ADP compounds hydrolase NudE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mqea_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1rrqa2 d.113.1.3 (A:234-360) Adenine glycosylase MutY, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1u20a1 d.113.1.1 (A:14-209) U8 snorna-binding protein x29 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1g0sa_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q33a_ d.113.1.1 (A:) NUDT9 (mitochondrial ADP-ribose pyrophosphatase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1viua_ d.113.1.1 (A:) ADP-ribose pyrophosphatase homologue YffH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x51a1 d.113.1.3 (A:8-149) A/G-specific adenine DNA glycosylase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure