Citrus Sinensis ID: 033060

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------13
MGRIFLVELKGRSYYKCRFCNSHLALADSVLSWSFNCRRGRAYLFSDVVNIMLGPQEERLMLSGMHTVEDIFCCCCGQIVGWKYVAAHDKNQKYKEGKFVLERWRIVEEVTEELSLETHTHSNEAETP
ccccEEEECccccEEEccccccccccccccccccccccccCEEEEcccEEEEEccccEEEEEEccEEEEEcccccccccEEEEEcEEccccCEEECcCEEEEEccccccccccccccccccccccccc
MGRIFLVELKGRSYYKCRFCNSHLALADSVLSWSFNCRRGRAYLFSDVVNIMLGPQEERLMLSGMHTVEDIFCCCCGQIVGWKYVAAHDKNQKYKEGKFVLERWRIVEEVTE****************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGRIFLVELKGRSYYKCRFCNSHLALADSVLSWSFNCRRGRAYLFSDVVNIMLGPQEERLMLSGMHTVEDIFCCCCGQIVGWKYVAAHDKNQKYKEGKFVLERWRIVEEVTEELSLETHTHSNEAETP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein yippee-like At5g53940 probableQ9FN32
Protein yippee-like probableP59234

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2QFD, chain A
Confidence level:confident
Coverage over the Query: 26-36,47-103
View the alignment between query and template
View the model in PyMOL
Template: 3EQT, chain A
Confidence level:probable
Coverage over the Query: 9-121
View the alignment between query and template
View the model in PyMOL