Citrus Sinensis ID: 033111

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------

MANFVVQLPKTNSFNLKRFCVSASSNGNPPGSSESRGSGPVILELPLDKIRRPLMRTRANDQNKVKELMDSIQQIGLQVPIDVIEVDGNYYGFSGCHRYEAHQRLGLPTIRCKVRRGTKETLRHHLR

ccccccccccccccccccEEEEcccccccccccccccccccEEEEccccccccccccccccHHHHHHHHHHHHHcccccccEEEEEccEEEEECcHHHHHHHHHcccccccEEEEEccHHHHHHHHc

*************FNLKRFC************************LPLDKIRRPLMRTRANDQNKVKELMDSIQQIGLQVPIDVIEVDGNYYGFSGCHRYEAHQRLGLPTIRCKVRRGTKETLRHHLR

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MANFVVQLPKTNSFNLKRFCVSASSNGNPPGSSESRGSGPVILELPLDKIRRPLMRTRANDQNKVKELMDSIQQIGLQVPIDVIEVDGNYYGFSGCHRYEAHQRLGLPTIRCKVRRGTKETLRHHLR

Annotation	Function Description	Confidence Level	Reference Protein
Sulfiredoxin, chloroplastic/mitochondrial	Contributes to oxidative stress resistance by reducing cysteine-sulfinic acid formed under exposure to oxidants in a peroxiredoxin. May catalyze the reduction in a multi-step process by acting both as a specific phosphotransferase and a thioltransferase. Required to switch on the antioxidant pathway to regenerate the oxidative damage. In mitochondrion, catalyzes the retroreduction of the inactive sulfinic form of atypical Prx IIF using thioredoxin as reducing agent.	confident	Q8GY89

No confident prediction of EC number!

Template: 1YZS, chain A
Confidence level:very confident
Coverage over the Query: 37-126
View the alignment between query and template
View the model in PyMOL