Citrus Sinensis ID: 033129

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120------
MALAFSREKILSATSQCMNFWRKMSTVSEKRNIEDHKRRLLATKFELKRKLYKSLYRDVNLPTEVREKYLCKLARLPRNSSFTRLRNRCIFTGRSRAVYEKFRMSRIVFRSLANQGMLMGVKKASW
ccccccccHHHHHcccHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHccccccccHHHcccccccccccHHHHcccccHHHHHHHHHcccccccccccc
**********LSATSQCMNFWRKMSTVSEKRNIEDHKRRLLATKFELKRKLYKSLYRDVNLPTEVREKYLCKLARLPRNSSFTRLRNRCIFTGRSRAVYEKFRMSRIVFRSLANQGMLMGVKKASW
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MALAFSREKILSATSQCMNFWRKMSTVSEKRNIEDHKRRLLATKFELKRKLYKSLYRDVNLPTEVREKYLCKLARLPRNSSFTRLRNRCIFTGRSRAVYEKFRMSRIVFRSLANQGMLMGVKKASW

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
28S ribosomal protein S14, mitochondrial probableQ9CR88
30S ribosomal protein S14 Binds 16S rRNA, required for the assembly of 30S particles and may also be responsible for determining the conformation of the 16S rRNA at the A site.probableQ28UU1
30S ribosomal protein S14 Binds 16S rRNA, required for the assembly of 30S particles and may also be responsible for determining the conformation of the 16S rRNA at the A site.probableQ0ANR3

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3BBN, chain N
Confidence level:very confident
Coverage over the Query: 28-126
View the alignment between query and template
View the model in PyMOL