Citrus Sinensis ID: 033131

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120------

MHVKAGDTVKVIAGCDKGKIGEITKVFRHNSTVMVKDINLKTKHVKKREEEEQGQIIKIEAPIHSSNVMLYSKEMEVASRVGHKVLDDGTRVRYLIKTGEIIDSAENWKKLKEANRQEKTEVATAA

cccccccEEEEEcccccccccEEEEEEcccccEEEccccEEEEccccccccccccEEEEECccEEcCEEEEEcccccccEEEEEEcccccEEEEEccccccccccHHHHHHHHccccccccccccc

MHVKAGDTVKVIAGCDKGKIGEITKVFRHNSTVMVKDINLK*****************IEAPIHSSNVMLYSKEMEVASRVGHKVLDDGTRVRYLIKTGEIIDSAENW******************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MHVKAGDTVKVIAGCDKGKIGEITKVFRHNSTVMVKDINLKTKHVKKREEEEQGQIIKIEAPIHSSNVMLYSKEMEVASRVGHKVLDDGTRVRYLIKTGEIIDSAENWKKLKEANRQEKTEVATAA

Annotation	Function Description	Confidence Level	Reference Protein
50S ribosomal protein L24	One of the proteins that surrounds the polypeptide exit tunnel on the outside of the subunit.	probable	A2C4Y8
50S ribosomal protein L24	One of the proteins that surrounds the polypeptide exit tunnel on the outside of the subunit.	probable	Q110B8
50S ribosomal protein L24	One of the proteins that surrounds the polypeptide exit tunnel on the outside of the subunit.	probable	B1XJS8

No EC number assigned to the protein, probably not an enzyme!

Template: 3BBO, chain W
Confidence level:very confident
Coverage over the Query: 1-106
View the alignment between query and template
View the model in PyMOL