Citrus Sinensis ID: 033131

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120------
MHVKAGDTVKVIAGCDKGKIGEITKVFRHNSTVMVKDINLKTKHVKKREEEEQGQIIKIEAPIHSSNVMLYSKEMEVASRVGHKVLDDGTRVRYLIKTGEIIDSAENWKKLKEANRQEKTEVATAA
cccccccEEEEEcccccccccEEEEEEcccccEEEccccEEEEccccccccccccEEEEEEccEEcEEEEEEcccccccEEEEEEcccccEEEEEccccccccccHHHHHHHHccccccccccccc
ccEccccEEEEEEEccccccEEEEEEEccccEEEEEcEEEEEEccccccccccccEEEEEccEEEccEEEEcccccccEEEEEEEEccccEEEEEEccccEEccHHHHHHHHHcccccEEEEEEcc
MHVKAGDTVKVIAgcdkgkigeitKVFRHNSTVMVKDINLKTKHVKKREEeeqgqiikieapihssnvmLYSKEMEVASRvghkvlddgtRVRYLIKTGEIIDSAENWKKLKEANRQEKTEVATAA
mhvkagdtvkviagcdkgkigeitkvfrhnstvmvkdinlktkhvkkreeeeqgqiikieapihssnVMLYSKEMEVASrvghkvlddgtrvrYLIKTgeiidsaenwkklkeanrqektevataa
MHVKAGDTVKVIAGCDKGKIGEITKVFRHNSTVMVKDINLKTKHVkkreeeeqgqiikieAPIHSSNVMLYSKEMEVASRVGHKVLDDGTRVRYLIKTGEIIDSAENWKKLKEANRQEKTEVATAA
*******TVKVIAGCDKGKIGEITKVFRHNSTVMVKDINL******************IEAPIHSSNVMLYSKEMEVASRVGHKVLDDGTRVRYLIKTGEIIDSAENW******************
MHVKAGDTVKVIAGCDKGKIGEITKVFRHNSTVMVKDINLK*******************APIHSSNVMLYSKEMEVASRVGHKVLDDGTRVRYLIKTGEIIDS**********************
MHVKAGDTVKVIAGCDKGKIGEITKVFRHNSTVMVKDINLKTKH*********GQIIKIEAPIHSSNVMLYSKEMEVASRVGHKVLDDGTRVRYLIKTGEIIDSAENWKKLKEA************
*HVKAGDTVKVIAGCDKGKIGEITKVFRHNSTVMVKDINLKTKHVKKREEEEQGQIIKIEAPIHSSNVMLYSKEMEVASRVGHKVLDDGTRVRYLIKTGEIIDSAENWKKLKEANRQEKTEVA***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHVKAGDTVKVIAGCDKGKIGEITKVFRHNSTVMVKDINLKTKHVKKREEEEQGQIIKIEAPIHSSNVMLYSKEMEVASRVGHKVLDDGTRVRYLIKTGEIIDSAENWKKLKEANRQEKTEVATAA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query126 2.2.26 [Sep-21-2011]
P92959198 50S ribosomal protein L24 yes no 1.0 0.636 0.730 3e-49
P11893194 50S ribosomal protein L24 N/A no 0.984 0.639 0.75 3e-48
Q02764187 50S ribosomal protein L24 N/A no 0.984 0.663 0.746 4e-48
P27683191 50S ribosomal protein L24 N/A no 0.984 0.649 0.672 6e-41
B0JHZ2117 50S ribosomal protein L24 yes no 0.817 0.880 0.601 3e-30
B1XJS8116 50S ribosomal protein L24 yes no 0.817 0.887 0.601 4e-30
Q8DMM1117 50S ribosomal protein L24 yes no 0.817 0.880 0.621 1e-29
B1WQS1115 50S ribosomal protein L24 yes no 0.825 0.904 0.596 2e-29
Q110B8122 50S ribosomal protein L24 yes no 0.817 0.844 0.601 3e-29
P73309115 50S ribosomal protein L24 N/A no 0.817 0.895 0.592 1e-28
>sp|P92959|RK24_ARATH 50S ribosomal protein L24, chloroplastic OS=Arabidopsis thaliana GN=RPL24 PE=2 SV=2 Back     alignment and function desciption
 Score =  193 bits (490), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 109/126 (86%)

Query: 1   MHVKAGDTVKVIAGCDKGKIGEITKVFRHNSTVMVKDINLKTKHVKKREEEEQGQIIKIE 60
           MHVK GDTVKVI+G DKGKIGE+TK+F HNST+++KD+NLKTKH+K REE E GQI+KIE
Sbjct: 71  MHVKFGDTVKVISGRDKGKIGEVTKIFTHNSTIVIKDVNLKTKHMKSREEGEPGQIVKIE 130

Query: 61  APIHSSNVMLYSKEMEVASRVGHKVLDDGTRVRYLIKTGEIIDSAENWKKLKEANRQEKT 120
           APIHSSNVMLYSKE +V SRVGHKVL+DG +VRYLIKTGE+ID+ E WK LKEA  +E T
Sbjct: 131 APIHSSNVMLYSKEKDVVSRVGHKVLEDGQKVRYLIKTGELIDTIEKWKLLKEAKDKETT 190

Query: 121 EVATAA 126
           +VA  +
Sbjct: 191 QVAVTS 196
One of two assembly initiator proteins, it binds directly to the 5'-end of the 23S rRNA, where it nucleates assembly of the 50S subunit.
Arabidopsis thaliana (taxid: 3702)
>sp|P11893|RK24_PEA 50S ribosomal protein L24, chloroplastic OS=Pisum sativum GN=RPL24 PE=2 SV=1 Back     alignment and function description
>sp|Q02764|RK24_TOBAC 50S ribosomal protein L24, chloroplastic OS=Nicotiana tabacum GN=RPL24 PE=1 SV=1 Back     alignment and function description
>sp|P27683|RK24_SPIOL 50S ribosomal protein L24, chloroplastic OS=Spinacia oleracea GN=RPL24 PE=1 SV=1 Back     alignment and function description
>sp|B0JHZ2|RL24_MICAN 50S ribosomal protein L24 OS=Microcystis aeruginosa (strain NIES-843) GN=rplX PE=3 SV=1 Back     alignment and function description
>sp|B1XJS8|RL24_SYNP2 50S ribosomal protein L24 OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=rplX PE=3 SV=1 Back     alignment and function description
>sp|Q8DMM1|RL24_THEEB 50S ribosomal protein L24 OS=Thermosynechococcus elongatus (strain BP-1) GN=rplX PE=3 SV=1 Back     alignment and function description
>sp|B1WQS1|RL24_CYAA5 50S ribosomal protein L24 OS=Cyanothece sp. (strain ATCC 51142) GN=rplX PE=3 SV=1 Back     alignment and function description
>sp|Q110B8|RL24_TRIEI 50S ribosomal protein L24 OS=Trichodesmium erythraeum (strain IMS101) GN=rplX PE=3 SV=1 Back     alignment and function description
>sp|P73309|RL24_SYNY3 50S ribosomal protein L24 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=rplX PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query126
449523692191 PREDICTED: LOW QUALITY PROTEIN: 50S ribo 0.984 0.649 0.841 2e-52
449463166191 PREDICTED: 50S ribosomal protein L24, ch 0.984 0.649 0.841 2e-52
224124188194 predicted protein [Populus trichocarpa] 0.960 0.623 0.813 2e-49
351723593194 uncharacterized protein LOC100306643 [Gl 0.928 0.603 0.803 7e-49
351725277193 uncharacterized protein LOC100500009 [Gl 0.928 0.606 0.786 5e-48
297792927198 50S ribosomal protein L24, chloroplast [ 1.0 0.636 0.730 7e-48
302143191 236 unnamed protein product [Vitis vinifera] 0.984 0.525 0.761 1e-47
225461164191 PREDICTED: 50S ribosomal protein L24, ch 0.984 0.649 0.761 1e-47
30696483198 50S ribosomal protein L24 [Arabidopsis t 1.0 0.636 0.730 2e-47
1694974198 plastid ribosomal protein [Arabidopsis t 1.0 0.636 0.722 3e-47
>gi|449523692|ref|XP_004168857.1| PREDICTED: LOW QUALITY PROTEIN: 50S ribosomal protein L24, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
 Score =  209 bits (533), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 112/126 (88%), Gaps = 2/126 (1%)

Query: 1   MHVKAGDTVKVIAGCDKGKIGEITKVFRHNSTVMVKDINLKTKHVKKREEEEQGQIIKIE 60
           MHVK GDTVKVIAG DKGKIGEITK+F+HNS V+V +INLKTKHVK REEEEQGQIIKIE
Sbjct: 68  MHVKIGDTVKVIAGRDKGKIGEITKIFKHNSKVVVNEINLKTKHVKSREEEEQGQIIKIE 127

Query: 61  APIHSSNVMLYSKEMEVASRVGHKVLDDGTRVRYLIKTGEIIDSAENWKKLKEANRQEKT 120
           APIHSSNVMLYSKE +V SRVGHKVL+DG RVRYLIKTGEIIDS ENWK LKEAN   KT
Sbjct: 128 APIHSSNVMLYSKEQDVVSRVGHKVLEDGKRVRYLIKTGEIIDSTENWKXLKEAN--SKT 185

Query: 121 EVATAA 126
           EVAT A
Sbjct: 186 EVATTA 191

Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|449463166|ref|XP_004149305.1| PREDICTED: 50S ribosomal protein L24, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224124188|ref|XP_002319267.1| predicted protein [Populus trichocarpa] gi|118484624|gb|ABK94184.1| unknown [Populus trichocarpa] gi|222857643|gb|EEE95190.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|351723593|ref|NP_001238052.1| uncharacterized protein LOC100306643 [Glycine max] gi|255629161|gb|ACU14925.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|351725277|ref|NP_001235551.1| uncharacterized protein LOC100500009 [Glycine max] gi|255628481|gb|ACU14585.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|297792927|ref|XP_002864348.1| 50S ribosomal protein L24, chloroplast [Arabidopsis lyrata subsp. lyrata] gi|297310183|gb|EFH40607.1| 50S ribosomal protein L24, chloroplast [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|302143191|emb|CBI20486.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225461164|ref|XP_002282889.1| PREDICTED: 50S ribosomal protein L24, chloroplastic isoform 1 [Vitis vinifera] gi|359493940|ref|XP_003634697.1| PREDICTED: 50S ribosomal protein L24, chloroplastic isoform 2 [Vitis vinifera] gi|359493942|ref|XP_003634698.1| PREDICTED: 50S ribosomal protein L24, chloroplastic isoform 3 [Vitis vinifera] gi|147860928|emb|CAN78749.1| hypothetical protein VITISV_002445 [Vitis vinifera] Back     alignment and taxonomy information
>gi|30696483|ref|NP_851190.1| 50S ribosomal protein L24 [Arabidopsis thaliana] gi|27735245|sp|P92959.2|RK24_ARATH RecName: Full=50S ribosomal protein L24, chloroplastic; AltName: Full=CL24; Flags: Precursor gi|9758952|dbj|BAB09339.1| 50S ribosomal protein L24, chloroplast precursor [Arabidopsis thaliana] gi|21555440|gb|AAM63859.1| 50S ribosomal protein L24, chloroplast precursor [Arabidopsis thaliana] gi|25082791|gb|AAN72001.1| 50S ribosomal protein L24, chloroplast precursor [Arabidopsis thaliana] gi|30102926|gb|AAP21381.1| At5g54600 [Arabidopsis thaliana] gi|332009133|gb|AED96516.1| 50S ribosomal protein L24 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|1694974|emb|CAA70851.1| plastid ribosomal protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query126
TAIR|locus:2172154198 RPL24 "plastid ribosomal prote 1.0 0.636 0.642 1.1e-39
TIGR_CMR|BA_0121103 BA_0121 "ribosomal protein L24 0.809 0.990 0.417 2.3e-14
TIGR_CMR|GSU_2846108 GSU_2846 "ribosomal protein L2 0.801 0.935 0.352 5.6e-13
TIGR_CMR|CBU_0249107 CBU_0249 "ribosomal protein L2 0.793 0.934 0.411 9.1e-13
TIGR_CMR|DET_0485103 DET_0485 "ribosomal protein L2 0.817 1.0 0.349 1.9e-12
TIGR_CMR|CHY_2298107 CHY_2298 "ribosomal protein L2 0.817 0.962 0.378 6.4e-12
TIGR_CMR|APH_0291104 APH_0291 "ribosomal protein L2 0.785 0.951 0.349 8.4e-10
TAIR|locus:504954880159 AT5G23535 [Arabidopsis thalian 0.738 0.584 0.372 1.1e-09
UNIPROTKB|P60627105 rplX "50S ribosomal protein L2 0.801 0.961 0.330 7.6e-09
TIGR_CMR|ECH_0420109 ECH_0420 "ribosomal protein L2 0.801 0.926 0.302 1.2e-08
TAIR|locus:2172154 RPL24 "plastid ribosomal protein L24" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 423 (154.0 bits), Expect = 1.1e-39, P = 1.1e-39
 Identities = 81/126 (64%), Positives = 97/126 (76%)

Query:     1 MHVKAGDTVKVIAGCDKGKIGEITKVFRHNSTVMVKDINLKTKHVXXXXXXXXXXXXXXX 60
             MHVK GDTVKVI+G DKGKIGE+TK+F HNST+++KD+NLKTKH+               
Sbjct:    71 MHVKFGDTVKVISGRDKGKIGEVTKIFTHNSTIVIKDVNLKTKHMKSREEGEPGQIVKIE 130

Query:    61 APIHSSNVMLYSKEMEVASRVGHKVLDDGTRVRYLIKTGEIIDSAENWKKLKEANRQEKT 120
             APIHSSNVMLYSKE +V SRVGHKVL+DG +VRYLIKTGE+ID+ E WK LKEA  +E T
Sbjct:   131 APIHSSNVMLYSKEKDVVSRVGHKVLEDGQKVRYLIKTGELIDTIEKWKLLKEAKDKETT 190

Query:   121 EVATAA 126
             +VA  +
Sbjct:   191 QVAVTS 196
GO:0003735 "structural constituent of ribosome" evidence=IEA;ISS
GO:0006412 "translation" evidence=ISS
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0015934 "large ribosomal subunit" evidence=ISS
GO:0009570 "chloroplast stroma" evidence=IDA
GO:0009941 "chloroplast envelope" evidence=IDA
GO:0032544 "plastid translation" evidence=IMP
GO:0019288 "isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway" evidence=RCA
TIGR_CMR|BA_0121 BA_0121 "ribosomal protein L24" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_2846 GSU_2846 "ribosomal protein L24" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TIGR_CMR|CBU_0249 CBU_0249 "ribosomal protein L24" [Coxiella burnetii RSA 493 (taxid:227377)] Back     alignment and assigned GO terms
TIGR_CMR|DET_0485 DET_0485 "ribosomal protein L24" [Dehalococcoides ethenogenes 195 (taxid:243164)] Back     alignment and assigned GO terms
TIGR_CMR|CHY_2298 CHY_2298 "ribosomal protein L24" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
TIGR_CMR|APH_0291 APH_0291 "ribosomal protein L24" [Anaplasma phagocytophilum HZ (taxid:212042)] Back     alignment and assigned GO terms
TAIR|locus:504954880 AT5G23535 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|P60627 rplX "50S ribosomal protein L24" [Mycobacterium tuberculosis (taxid:1773)] Back     alignment and assigned GO terms
TIGR_CMR|ECH_0420 ECH_0420 "ribosomal protein L24" [Ehrlichia chaffeensis str. Arkansas (taxid:205920)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
A7GJ63RL24_CLOBLNo assigned EC number0.520.79360.9523yesno
A2C4Y8RL24_PROM1No assigned EC number0.50480.81740.8728yesno
Q0ID16RL24_SYNS3No assigned EC number0.47570.81741.0yesno
Q110B8RL24_TRIEINo assigned EC number0.60190.81740.8442yesno
Q1XDI5RK24_PORYENo assigned EC number0.50980.80950.8793N/Ano
C3KVP0RL24_CLOB6No assigned EC number0.520.79360.9523yesno
Q7V9X3RL24_PROMANo assigned EC number0.48540.81740.8728yesno
B1IGE3RL24_CLOBKNo assigned EC number0.520.79360.9523yesno
B1XJS8RL24_SYNP2No assigned EC number0.60190.81740.8879yesno
A3PF36RL24_PROM0No assigned EC number0.48540.81740.8728yesno
Q3MFB0RL24_ANAVTNo assigned EC number0.58650.82530.8888yesno
Q3AMP1RL24_SYNSCNo assigned EC number0.48540.81740.8728yesno
Q46IS0RL24_PROMTNo assigned EC number0.49510.81740.8728yesno
Q7UZV5RL24_PROMPNo assigned EC number0.46600.81740.8728yesno
Q7NEG3RL24_GLOVINo assigned EC number0.53390.80950.8793yesno
B1WQS1RL24_CYAA5No assigned EC number0.59610.82530.9043yesno
B1KSL4RL24_CLOBMNo assigned EC number0.520.79360.9523yesno
B0C1E4RL24_ACAM1No assigned EC number0.61160.81740.8956yesno
A0PXV7RL24_CLONNNo assigned EC number0.50.80950.9714yesno
A2CC38RL24_PROM3No assigned EC number0.48540.81740.8728yesno
Q02764RK24_TOBACNo assigned EC number0.74600.98410.6631N/Ano
Q8DMM1RL24_THEEBNo assigned EC number0.62130.81740.8803yesno
A2BYS5RL24_PROM5No assigned EC number0.47570.81740.8728yesno
Q31L18RL24_SYNE7No assigned EC number0.61160.81740.9115yesno
O24700RL24_SYNP6No assigned EC number0.61160.81740.9115yesno
A5GIT4RL24_SYNPWNo assigned EC number0.49510.81740.8728yesno
B2ITP4RL24_NOSP7No assigned EC number0.60190.81740.8803yesno
A5I7J5RL24_CLOBHNo assigned EC number0.510.79360.9523yesno
C1FMU0RL24_CLOBJNo assigned EC number0.510.79360.9523yesno
Q2JQN1RL24_SYNJANo assigned EC number0.54360.81740.7803yesno
A2BTC6RL24_PROMSNo assigned EC number0.48540.81740.8728yesno
Q2JIL6RL24_SYNJBNo assigned EC number0.52420.81740.7803yesno
A7FZ58RL24_CLOB1No assigned EC number0.510.79360.9523yesno
Q7U4I9RL24_SYNPXNo assigned EC number0.47570.81740.8728yesno
B7GJ78RL24_ANOFWNo assigned EC number0.49510.80950.9902yesno
P73309RL24_SYNY3No assigned EC number0.59220.81740.8956N/Ano
P92959RK24_ARATHNo assigned EC number0.73011.00.6363yesno
A8G750RL24_PROM2No assigned EC number0.48540.81740.8728yesno
B0JHZ2RL24_MICANNo assigned EC number0.60190.81740.8803yesno
P11893RK24_PEANo assigned EC number0.750.98410.6391N/Ano
Q318J5RL24_PROM9No assigned EC number0.48540.81740.8728yesno
A5GVX1RL24_SYNR3No assigned EC number0.49510.81740.9115yesno
O46905RK24_GUITHNo assigned EC number0.50520.75390.9405yesno
Q7V534RL24_PROMMNo assigned EC number0.48540.81740.8728yesno
Q3AW82RL24_SYNS9No assigned EC number0.48540.81740.8728yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query126
PRK00004105 PRK00004, rplX, 50S ribosomal protein L24; Reviewe 2e-40
TIGR01079104 TIGR01079, rplX_bact, ribosomal protein L24, bacte 5e-35
CHL0014183 CHL00141, rpl24, ribosomal protein L24; Validated 2e-26
COG0198104 COG0198, RplX, Ribosomal protein L24 [Translation, 2e-26
cd0608965 cd06089, KOW_RPL26, KOW motif of Ribosomal Protein 3e-23
PRK1228176 PRK12281, rplX, 50S ribosomal protein L24; Reviewe 5e-16
PRK01191120 PRK01191, rpl24p, 50S ribosomal protein L24P; Vali 6e-05
pfam0046732 pfam00467, KOW, KOW motif 2e-04
cd0038049 cd00380, KOW, KOW: an acronym for the authors' sur 0.004
>gnl|CDD|234566 PRK00004, rplX, 50S ribosomal protein L24; Reviewed Back     alignment and domain information 
 Score =  129 bits (328), Expect = 2e-40
 Identities = 52/103 (50%), Positives = 68/103 (66%)

Query: 1   MHVKAGDTVKVIAGCDKGKIGEITKVFRHNSTVMVKDINLKTKHVKKREEEEQGQIIKIE 60
           M +K GDTV VIAG DKGK G++ KV    + V+V+ +N+  KH K  +E  QG II+ E
Sbjct: 3   MKIKKGDTVIVIAGKDKGKRGKVLKVLPKKNKVIVEGVNIVKKHQKPNQENPQGGIIEKE 62

Query: 61  APIHSSNVMLYSKEMEVASRVGHKVLDDGTRVRYLIKTGEIID 103
           APIH SNV L   +   A+RVG K L+DG +VR   K+GE+ID
Sbjct: 63  APIHISNVALVDPKTGKATRVGFKFLEDGKKVRVAKKSGEVID 105

Length = 105
>gnl|CDD|233263 TIGR01079, rplX_bact, ribosomal protein L24, bacterial/organelle Back     alignment and domain information
>gnl|CDD|214374 CHL00141, rpl24, ribosomal protein L24; Validated Back     alignment and domain information
>gnl|CDD|223276 COG0198, RplX, Ribosomal protein L24 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|240513 cd06089, KOW_RPL26, KOW motif of Ribosomal Protein L26 Back     alignment and domain information
>gnl|CDD|183399 PRK12281, rplX, 50S ribosomal protein L24; Reviewed Back     alignment and domain information
>gnl|CDD|234915 PRK01191, rpl24p, 50S ribosomal protein L24P; Validated Back     alignment and domain information
>gnl|CDD|144165 pfam00467, KOW, KOW motif Back     alignment and domain information
>gnl|CDD|240504 cd00380, KOW, KOW: an acronym for the authors' surnames (Kyrpides, Ouzounis and Woese) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 126
TIGR01079104 rplX_bact ribosomal protein L24, bacterial/organel 100.0
PRK00004105 rplX 50S ribosomal protein L24; Reviewed 100.0
COG0198104 RplX Ribosomal protein L24 [Translation, ribosomal 100.0
KOG1708236 consensus Mitochondrial/chloroplast ribosomal prot 99.97
CHL0014183 rpl24 ribosomal protein L24; Validated 99.96
PRK1228176 rplX 50S ribosomal protein L24; Reviewed 99.95
PTZ00194143 60S ribosomal protein L26; Provisional 99.86
PRK01191120 rpl24p 50S ribosomal protein L24P; Validated 99.86
TIGR01080114 rplX_A_E ribosomal protein L24p/L26e, archaeal/euk 99.82
PF0046732 KOW: KOW motif; InterPro: IPR005824 Ribosomes are 98.88
KOG3401145 consensus 60S ribosomal protein L26 [Translation, 98.71
smart0073928 KOW KOW (Kyprides, Ouzounis, Woese) motif. Motif i 97.98
PRK08559153 nusG transcription antitermination protein NusG; V 97.57
TIGR00405145 L26e_arch ribosomal protein L24p/L26e, archaeal. T 97.55
PRK05609181 nusG transcription antitermination protein NusG; V 97.13
TIGR00922172 nusG transcription termination/antitermination fac 97.09
COG0250178 NusG Transcription antiterminator [Transcription] 96.95
TIGR01955159 RfaH transcriptional activator RfaH. This model re 96.54
PRK09014162 rfaH transcriptional activator RfaH; Provisional 96.29
TIGR01956258 NusG_myco NusG family protein. This model represen 96.27
PRK0433384 50S ribosomal protein L14e; Validated 95.21
PTZ00065130 60S ribosomal protein L14; Provisional 91.42
PTZ00471134 60S ribosomal protein L27; Provisional 90.54
KOG1999 1024 consensus RNA polymerase II transcription elongati 90.47
COG2163125 RPL14A Ribosomal protein L14E/L6E/L27E [Translatio 84.7
PRK04313237 30S ribosomal protein S4e; Validated 82.73
PRK06531113 yajC preprotein translocase subunit YajC; Validate 80.1
>TIGR01079 rplX_bact ribosomal protein L24, bacterial/organelle Back     alignment and domain information 
Probab=100.00  E-value=8.9e-40  Score=233.25  Aligned_cols=102  Identities=51%  Similarity=0.779  Sum_probs=98.6

Q ss_pred             CCcccCCEEEEeecCCCCeEeEEEEEEccCCeEEEeceeeeEEEecCCcccC-CceEEEEeecCcCCCeeeeecCCCCee
Q 033131            1 MHVKAGDTVKVIAGCDKGKIGEITKVFRHNSTVMVKDINLKTKHVKKREEEE-QGQIIKIEAPIHSSNVMLYSKEMEVAS   79 (126)
Q Consensus         1 ~~I~kGD~V~Vi~GkdKGK~G~V~~V~~~~~~V~VeGvN~~kkh~k~~~~~~-~ggi~~~e~pI~~SNV~Lv~p~~~~~~   79 (126)
                      |+|++||+|+||+|+|||++|+|++|++++++|+|||+|+.++|++|++.++ +|+|+++|+|||+|||+|+||.+++|+
T Consensus         2 ~~ikkGD~V~Vi~G~dKGK~G~V~~V~~~~~~V~VegvN~~kkh~k~~~~~~~~g~i~~~e~pI~~SnV~lv~p~~~k~~   81 (104)
T TIGR01079         2 MKIKKGDTVKVISGKDKGKRGKVLKVLPKTNKVIVEGVNMVKKHVKPKPTQRSQGGIIEKEAPIHISNVMLFDPKTGKAT   81 (104)
T ss_pred             CcccCCCEEEEeEcCCCCcEEEEEEEEcCCCEEEECCcEEEEEecCcccCCCCCCceEEEEccCCHHHeEEEcCcCCCCe
Confidence            6899999999999999999999999999999999999999999999988776 899999999999999999999999999


Q ss_pred             eEEEEEccCCcEEEEEcccCccc
Q 033131           80 RVGHKVLDDGTRVRYLIKTGEII  102 (126)
Q Consensus        80 rv~~~~~~dG~kvRv~k~sg~~i  102 (126)
                      |++|++++||+++|+|++||+.|
T Consensus        82 rv~~~~~~~g~kvRv~k~~g~~i  104 (104)
T TIGR01079        82 RVGIRFEEDGKKVRVFKKTGEII  104 (104)
T ss_pred             EEEEEEccCCcEEEEEeccCCcC
Confidence            99999999999999999999875

This model recognizes bacterial and organellar forms of ribosomal protein L24. It excludes eukaryotic and archaeal forms, designated L26 in eukaryotes.
>PRK00004 rplX 50S ribosomal protein L24; Reviewed Back     alignment and domain information
>COG0198 RplX Ribosomal protein L24 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1708 consensus Mitochondrial/chloroplast ribosomal protein L24 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>CHL00141 rpl24 ribosomal protein L24; Validated Back     alignment and domain information
>PRK12281 rplX 50S ribosomal protein L24; Reviewed Back     alignment and domain information
>PTZ00194 60S ribosomal protein L26; Provisional Back     alignment and domain information
>PRK01191 rpl24p 50S ribosomal protein L24P; Validated Back     alignment and domain information
>TIGR01080 rplX_A_E ribosomal protein L24p/L26e, archaeal/eukaryotic Back     alignment and domain information
>PF00467 KOW: KOW motif; InterPro: IPR005824 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>KOG3401 consensus 60S ribosomal protein L26 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>smart00739 KOW KOW (Kyprides, Ouzounis, Woese) motif Back     alignment and domain information
>PRK08559 nusG transcription antitermination protein NusG; Validated Back     alignment and domain information
>TIGR00405 L26e_arch ribosomal protein L24p/L26e, archaeal Back     alignment and domain information
>PRK05609 nusG transcription antitermination protein NusG; Validated Back     alignment and domain information
>TIGR00922 nusG transcription termination/antitermination factor NusG Back     alignment and domain information
>COG0250 NusG Transcription antiterminator [Transcription] Back     alignment and domain information
>TIGR01955 RfaH transcriptional activator RfaH Back     alignment and domain information
>PRK09014 rfaH transcriptional activator RfaH; Provisional Back     alignment and domain information
>TIGR01956 NusG_myco NusG family protein Back     alignment and domain information
>PRK04333 50S ribosomal protein L14e; Validated Back     alignment and domain information
>PTZ00065 60S ribosomal protein L14; Provisional Back     alignment and domain information
>PTZ00471 60S ribosomal protein L27; Provisional Back     alignment and domain information
>KOG1999 consensus RNA polymerase II transcription elongation factor DSIF/SUPT5H/SPT5 [Transcription] Back     alignment and domain information
>COG2163 RPL14A Ribosomal protein L14E/L6E/L27E [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK04313 30S ribosomal protein S4e; Validated Back     alignment and domain information
>PRK06531 yajC preprotein translocase subunit YajC; Validated Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query126
3bbo_W191 Homology Model For The Spinach Chloroplast 50s Subu 4e-34
3mrz_U109 Recognition Of The Amber Stop Codon By Release Fact 6e-10
2j01_Y110 Structure Of The Thermus Thermophilus 70s Ribosome 7e-10
3tve_U102 Crystal Structure Analysis Of Ribosomal Decoding. T 1e-08
1nkw_S115 Crystal Structure Of The Large Ribosomal Subunit Fr 6e-08
3fin_Y101 T. Thermophilus 70s Ribosome In Complex With Mrna, 6e-08
3pyo_U100 Crystal Structure Of A Complex Containing Domain 3 7e-08
1pnu_S113 Crystal Structure Of A Streptomycin Dependent Ribos 3e-07
>pdb|3BBO|W Chain W, Homology Model For The Spinach Chloroplast 50s Subunit Fitted To 9.4a Cryo-Em Map Of The 70s Chlororibosome Length = 191 Back     alignment and structure 
Iteration: 1

 Score =  139 bits (350), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 72/125 (57%), Positives = 89/125 (71%), Gaps = 1/125 (0%)
Query: 2   HVKAGDTVKVIAGCDKGKIGEITKVFRHNSTVMVKDINLKTKHVXXXXXXXXXXXXXXXA 61
           HVK GDTVKVI+G +KGKIGEI+K+ +HNSTV++KD+N KTKHV               A
Sbjct: 68  HVKVGDTVKVISGGEKGKIGEISKIHKHNSTVIIKDLNFKTKHVKSKEEGEQGQIIKIEA 127
Query: 62  PIHSSNVMLYSKEMEVASRVGHKVLDDGTRVRYLIKTGEIIDSAENWKKLKEANRQEKTE 121
            IHSSNVML  KE EVA RVGHK+L+D  +VRYLIKTGEI+D+ + WK+++     E T 
Sbjct: 128 AIHSSNVMLILKEQEVADRVGHKILEDVRKVRYLIKTGEIVDTPDRWKEIQNKKESE-TA 186
Query: 122 VATAA 126
           VA AA
Sbjct: 187 VAVAA 191
>pdb|3MRZ|U Chain U, Recognition Of The Amber Stop Codon By Release Factor Rf1. This Entry 3mrz Contains 50s Ribosomal Subunit. The 30s Ribosomal Subunit Can Be Found In Pdb Entry 3ms0. Molecule A In The Same Asymmetric Unit Is Deposited As 3mr8 (50s) And 3ms1 (30s). Length = 109 Back     alignment and structure
>pdb|2J01|Y Chain Y, Structure Of The Thermus Thermophilus 70s Ribosome Complexed With Mrna, Trna And Paromomycin (Part 2 Of 4). This File Contains The 50s Subunit From Molecule I. Length = 110 Back     alignment and structure
>pdb|3TVE|U Chain U, Crystal Structure Analysis Of Ribosomal Decoding. This Entry Contains The 50s Ribosomal Subunit Of The First 70s Molecule In The Asymmetric Unit For The Cognate Trna-Leu Complex Length = 102 Back     alignment and structure
>pdb|1NKW|S Chain S, Crystal Structure Of The Large Ribosomal Subunit From Deinococcus Radiodurans Length = 115 Back     alignment and structure
>pdb|3FIN|Y Chain Y, T. Thermophilus 70s Ribosome In Complex With Mrna, Trnas And Ef- Tu.Gdp.Kirromycin Ternary Complex, Fitted To A 6.4 A Cryo-Em Map. This File Contains The 50s Subunit Length = 101 Back     alignment and structure
>pdb|3PYO|U Chain U, Crystal Structure Of A Complex Containing Domain 3 From The Psiv Igr Ires Rna Bound To The 70s Ribosome. This File Contains The 50s Subunit Of The First 70s Ribosome. Length = 100 Back     alignment and structure
>pdb|1PNU|S Chain S, Crystal Structure Of A Streptomycin Dependent Ribosome From Escherichia Coli, 50s Subunit Of 70s Ribosome. This File, 1pnu, Contains Only Molecules Of The 50s Ribosomal Subunit. The 30s Subunit, Mrna, P-Site Trna, And A-Site Trna Are In The Pdb File 1pns. Length = 113 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query126
3bbo_W191 Ribosomal protein L24; large ribosomal subunit, sp 1e-46
3v2d_Y110 50S ribosomal protein L24; ribosome associated inh 1e-39
2ftc_N96 Mitochondrial ribosomal protein L24; mitochondrial 3e-36
2zjr_R115 50S ribosomal protein L24; ribosome, large ribosom 5e-36
3r8s_U102 50S ribosomal protein L24; protein biosynthesis, R 8e-28
1vq8_T120 50S ribosomal protein L24P; ribosome 50S, protein- 2e-10
3u5e_Y127 L33, YL33, 60S ribosomal protein L26-A; translatio 2e-06
4a17_S135 RPL26, 60S ribosomal protein L21; eukaryotic ribos 6e-06
3iz5_Y150 60S ribosomal protein L26 (L24P); eukaryotic ribos 9e-05
>3bbo_W Ribosomal protein L24; large ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} Length = 191 Back     alignment and structure
 Score =  147 bits (373), Expect = 1e-46
 Identities = 80/125 (64%), Positives = 98/125 (78%)

Query: 1   MHVKAGDTVKVIAGCDKGKIGEITKVFRHNSTVMVKDINLKTKHVKKREEEEQGQIIKIE 60
            HVK GDTVKVI+G +KGKIGEI+K+ +HNSTV++KD+N KTKHVK +EE EQGQIIKIE
Sbjct: 67  RHVKVGDTVKVISGGEKGKIGEISKIHKHNSTVIIKDLNFKTKHVKSKEEGEQGQIIKIE 126

Query: 61  APIHSSNVMLYSKEMEVASRVGHKVLDDGTRVRYLIKTGEIIDSAENWKKLKEANRQEKT 120
           A IHSSNVML  KE EVA RVGHK+L+D  +VRYLIKTGEI+D+ + WK+++     E  
Sbjct: 127 AAIHSSNVMLILKEQEVADRVGHKILEDVRKVRYLIKTGEIVDTPDRWKEIQNKKESETA 186

Query: 121 EVATA 125
               A
Sbjct: 187 VAVAA 191
>3v2d_Y 50S ribosomal protein L24; ribosome associated inhibitor A, RAIA, protein Y, stress RES stationary phase, ribosome hibernation, ribosome; 2.70A {Thermus thermophilus} PDB: 1vsp_S 2hgj_X 2hgq_X 2hgu_X 1vsa_S 2j03_Y 2jl6_Y 2jl8_Y 2v47_Y 2v49_Y 2wdi_Y 2wdj_Y 2wdl_Y 2wdn_Y 2wh2_Y 2wh4_Y 2wrj_Y 2wrl_Y 2wro_Y 2wrr_Y ... Length = 110 Back     alignment and structure
>2ftc_N Mitochondrial ribosomal protein L24; mitochondrial ribosome, large ribosomal subunit, ribosomal R ribosome; 12.10A {Bos taurus} PDB: 3iy9_N Length = 96 Back     alignment and structure
>2zjr_R 50S ribosomal protein L24; ribosome, large ribosomal subunit, ribonucleoprotein, RNA-binding, rRNA-binding, tRNA-binding, methylation; 2.91A {Deinococcus radiodurans} SCOP: b.34.5.1 PDB: 1nwx_S* 1nwy_S* 1sm1_S* 1xbp_S* 2d3o_S 2zjp_R* 2zjq_R 1nkw_S 3cf5_R* 3dll_R* 3pio_R* 3pip_R* 1pnu_S 1pny_S 1vor_V 1vou_V 1vow_V 1voy_V 1vp0_V Length = 115 Back     alignment and structure
>3r8s_U 50S ribosomal protein L24; protein biosynthesis, RNA, tRNA, transfer RNA, 23S ribosomal subunit, ribosome recycling factor, RRF, ribosome; 3.00A {Escherichia coli} PDB: 2j28_U* 3fik_U 2wwq_U 3oat_U* 3oas_U* 3ofd_U 3ofc_U 3ofr_U* 3ofz_U* 3og0_U 3ofq_U 3r8t_U 3i1n_U 1vs8_U 1vs6_U 1vt2_U 3i1p_U 3i1r_U 3i1t_U 3i20_U ... Length = 102 Back     alignment and structure
>1vq8_T 50S ribosomal protein L24P; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: b.34.5.1 PDB: 1vq4_T* 1vq5_T* 1vq6_T* 1vq7_T* 1s72_T* 1vq9_T* 1vqk_T* 1vql_T* 1vqm_T* 1vqn_T* 1vqo_T* 1vqp_T* 1yhq_T* 1yi2_T* 1yij_T* 1yit_T* 1yj9_T* 1yjn_T* 1yjw_T* 2otj_T* ... Length = 120 Back     alignment and structure
>3u5e_Y L33, YL33, 60S ribosomal protein L26-A; translation, ribosome, ribosomal R ribosomal protein, STM1, eukaryotic ribosome; 3.00A {Saccharomyces cerevisiae} PDB: 2wwa_L 2ww9_L 2wwb_L 3o5h_X 3o58_X 3u5i_Y 1s1i_U 3izc_Y 3izs_Y 3jyw_U Length = 127 Back     alignment and structure
>4a17_S RPL26, 60S ribosomal protein L21; eukaryotic ribosome, ribosome, eukaryotic initiation factor 60S, translation, large ribosomal subunit; 3.52A {Tetrahymena thermophila} PDB: 4a1a_S 4a1c_S 4a1e_S Length = 135 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query126
3v2d_Y110 50S ribosomal protein L24; ribosome associated inh 100.0
3bbo_W191 Ribosomal protein L24; large ribosomal subunit, sp 100.0
3r8s_U102 50S ribosomal protein L24; protein biosynthesis, R 100.0
2ftc_N96 Mitochondrial ribosomal protein L24; mitochondrial 100.0
2zjr_R115 50S ribosomal protein L24; ribosome, large ribosom 100.0
1vq8_T120 50S ribosomal protein L24P; ribosome 50S, protein- 99.91
3j21_U121 50S ribosomal protein L24P; archaea, archaeal, KIN 99.9
2zkr_t145 60S ribosomal protein L26; protein-RNA complex, 60 99.88
3u5e_Y127 L33, YL33, 60S ribosomal protein L26-A; translatio 99.87
4a17_S135 RPL26, 60S ribosomal protein L21; eukaryotic ribos 99.87
3iz5_Y150 60S ribosomal protein L26 (L24P); eukaryotic ribos 99.86
1nz9_A58 Transcription antitermination protein NUSG; transc 98.23
3p8b_B152 Transcription antitermination protein NUSG; transc 97.74
2e6z_A59 Transcription elongation factor SPT5; KOW motif, s 97.42
2jvv_A181 Transcription antitermination protein NUSG; transc 97.2
2do3_A69 Transcription elongation factor SPT5; KOW motif, s 97.16
2ckk_A127 KIN17; beta barrel, ribosomal protein, ribonucleop 96.84
2xhc_A352 Transcription antitermination protein NUSG; 2.45A 96.31
1m1h_A248 Transcription antitermination protein NUSG; transc 95.82
4a18_F126 RPL14; ribosome, eukaryotic initiation factor 6, E 94.57
3izc_N138 60S ribosomal protein RPL14 (L14E); eukaryotic rib 93.12
2joy_A96 50S ribosomal protein L14E; protein solution struc 93.06
4a18_N144 RPL27, ribosomal protein L22; ribosome, eukaryotic 93.04
3iz5_N134 60S ribosomal protein L14 (L14E); eukaryotic ribos 92.88
3j21_583 50S ribosomal protein L14E; archaea, archaeal, KIN 92.06
2e70_A71 Transcription elongation factor SPT5; KOW motif, s 91.32
3iz5_G219 60S ribosomal protein L6 (L6E); eukaryotic ribosom 82.34
>3v2d_Y 50S ribosomal protein L24; ribosome associated inhibitor A, RAIA, protein Y, stress RES stationary phase, ribosome hibernation, ribosome; 2.70A {Thermus thermophilus} PDB: 1vsp_S 2hgj_X 2hgq_X 2hgu_X 1vsa_S 2j03_Y 2jl6_Y 2jl8_Y 2v47_Y 2v49_Y 2wdi_Y 2wdj_Y 2wdl_Y 2wdn_Y 2wh2_Y 2wh4_Y 2wrj_Y 2wrl_Y 2wro_Y 2wrr_Y ... Back     alignment and structure
Probab=100.00  E-value=6.8e-44  Score=255.82  Aligned_cols=106  Identities=36%  Similarity=0.570  Sum_probs=101.1

Q ss_pred             CCcccCCEEEEeecCCCCeEeEEEEEEccCCeEEEeceeeeEEEecCCcccCCceEEEEeecCcCCCeeeeecCCCCeee
Q 033131            1 MHVKAGDTVKVIAGCDKGKIGEITKVFRHNSTVMVKDINLKTKHVKKREEEEQGQIIKIEAPIHSSNVMLYSKEMEVASR   80 (126)
Q Consensus         1 ~~I~kGD~V~Vi~GkdKGK~G~V~~V~~~~~~V~VeGvN~~kkh~k~~~~~~~ggi~~~e~pI~~SNV~Lv~p~~~~~~r   80 (126)
                      |+|++||+|+||+|+|||++|+|++|++++++|+|||+|++++|+||++++.+|||+++|+|||+|||+|+||.+++|||
T Consensus         5 ~~IkkGD~V~Vi~GkdKGk~GkV~~V~~~~~~ViVEGvN~~kkh~kp~~~~~~Ggi~~~E~PIh~SNV~lv~p~~~k~tR   84 (110)
T 3v2d_Y            5 MHVKKGDTVLVASGKYKGRVGKVKEVLPKKYAVIVEGVNIVKKAVRVSPKYPQGGFIEKEAPLHASKVRPICPACGKPTR   84 (110)
T ss_dssp             CSCCTTSEEEECSSTTTTCEEEEEEEEGGGTEEEETTSSEEEEECCSSSSSTTCCEEEEECCEEGGGEEEBCTTTCSBCC
T ss_pred             cccCCCCEEEEeEcCCCCeEeEEEEEECCCCEEEEeCEEEEEEEeCCCccCCCCCEEEEECCcCHHHeEEEcCcCCCccE
Confidence            58999999999999999999999999999999999999999999999988889999999999999999999999999999


Q ss_pred             EEEEEccCCcEEEEEcccCcccccch
Q 033131           81 VGHKVLDDGTRVRYLIKTGEIIDSAE  106 (126)
Q Consensus        81 v~~~~~~dG~kvRv~k~sg~~i~~p~  106 (126)
                      |+|++++||+++|||++||++|+.||
T Consensus        85 vg~~~~edG~kvRv~kk~g~~i~~~~  110 (110)
T 3v2d_Y           85 VRKKFLENGKKIRVCAKCGGALDTEE  110 (110)
T ss_dssp             EEEEECSSCCEEEEESSSCCBCC---
T ss_pred             EEEEECCCCcEEEEEecCCCccCCCC
Confidence            99999999999999999999999875
>3bbo_W Ribosomal protein L24; large ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} Back     alignment and structure
>3r8s_U 50S ribosomal protein L24; protein biosynthesis, RNA, tRNA, transfer RNA, 23S ribosomal subunit, ribosome recycling factor, RRF, ribosome; 3.00A {Escherichia coli} PDB: 2j28_U* 3fik_U 3j19_U 2wwq_U 3oat_U* 3oas_U* 3ofd_U 3ofc_U 3ofr_U* 3ofz_U* 3og0_U 3ofq_U 3r8t_U 3i1n_U 1vs8_U 1vs6_U 1vt2_U 3i1p_U 3i1r_U 3i1t_U ... Back     alignment and structure
>2ftc_N Mitochondrial ribosomal protein L24; mitochondrial ribosome, large ribosomal subunit, ribosomal R ribosome; 12.10A {Bos taurus} PDB: 3iy9_N Back     alignment and structure
>2zjr_R 50S ribosomal protein L24; ribosome, large ribosomal subunit, ribonucleoprotein, RNA-binding, rRNA-binding, tRNA-binding, methylation; 2.91A {Deinococcus radiodurans} SCOP: b.34.5.1 PDB: 1nwx_S* 1nwy_S* 1sm1_S* 1xbp_S* 2d3o_S 2zjp_R* 2zjq_R 1nkw_S 3cf5_R* 3dll_R* 3pio_R* 3pip_R* 1pnu_S 1pny_S 1vor_V 1vou_V 1vow_V 1voy_V 1vp0_V Back     alignment and structure
>1vq8_T 50S ribosomal protein L24P; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: b.34.5.1 PDB: 1vq4_T* 1vq5_T* 1vq6_T* 1vq7_T* 1s72_T* 1vq9_T* 1vqk_T* 1vql_T* 1vqm_T* 1vqn_T* 1vqo_T* 1vqp_T* 1yhq_T* 1yi2_T* 1yij_T* 1yit_T* 1yj9_T* 1yjn_T* 1yjw_T* 2otj_T* ... Back     alignment and structure
>3j21_U 50S ribosomal protein L24P; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} Back     alignment and structure
>2zkr_t 60S ribosomal protein L26; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} Back     alignment and structure
>3u5e_Y L33, YL33, 60S ribosomal protein L26-A; translation, ribosome, ribosomal R ribosomal protein, STM1, eukaryotic ribosome; 3.00A {Saccharomyces cerevisiae} PDB: 2wwa_L 2ww9_L 2wwb_L 3o5h_X 3o58_X 3u5i_Y 4b6a_Y 1s1i_U 3izc_Y 3izs_Y 3jyw_U Back     alignment and structure
>4a17_S RPL26, 60S ribosomal protein L21; eukaryotic ribosome, ribosome, eukaryotic initiation factor 60S, translation, large ribosomal subunit; 3.52A {Tetrahymena thermophila} PDB: 4a1a_S 4a1c_S 4a1e_S Back     alignment and structure
>1nz9_A Transcription antitermination protein NUSG; transcription elongation, riken structural genomics/proteomics initiative, RSGI; NMR {Thermus thermophilus} SCOP: b.34.5.4 Back     alignment and structure
>3p8b_B Transcription antitermination protein NUSG; transcription elongation factor, RNA polymerase, transferase transcription complex; 1.80A {Pyrococcus furiosus} PDB: 3qqc_D Back     alignment and structure
>2e6z_A Transcription elongation factor SPT5; KOW motif, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2jvv_A Transcription antitermination protein NUSG; transcription factor, transcription regulation, transcription termination; NMR {Escherichia coli} PDB: 2k06_A 2kvq_G Back     alignment and structure
>2do3_A Transcription elongation factor SPT5; KOW motif, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.34.5.5 Back     alignment and structure
>2ckk_A KIN17; beta barrel, ribosomal protein, ribonucleoprotein, nuclear protein; 1.45A {Homo sapiens} Back     alignment and structure
>2xhc_A Transcription antitermination protein NUSG; 2.45A {Thermotoga maritima} Back     alignment and structure
>1m1h_A Transcription antitermination protein NUSG; transcription termination, RNP motif, immunoglobulin fold, nucleic acid interaction; 1.95A {Aquifex aeolicus} SCOP: b.114.1.1 d.58.42.1 PDB: 1m1g_A 1npp_A 1npr_A Back     alignment and structure
>4a18_F RPL14; ribosome, eukaryotic initiation factor 6, EIF6, transla large ribosomal subunit, rRNA; 3.52A {Tetrahymena thermophila} PDB: 4a19_F 4a1b_F 4a1d_F 4adx_7 Back     alignment and structure
>2joy_A 50S ribosomal protein L14E; protein solution structure, structural genomics, PSI-2, protein structure initiative; NMR {Sulfolobus solfataricus} SCOP: b.34.5.7 PDB: 2kds_A Back     alignment and structure
>4a18_N RPL27, ribosomal protein L22; ribosome, eukaryotic initiation factor 6, EIF6, transla large ribosomal subunit, rRNA; 3.52A {Tetrahymena thermophila} PDB: 4a19_N 4a1b_N 4a1d_N Back     alignment and structure
>3j21_5 50S ribosomal protein L14E; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} Back     alignment and structure
>2e70_A Transcription elongation factor SPT5; KOW motif, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 126
d2j01y1101 b.34.5.1 (Y:2-102) Ribosomal proteins L24 (L24p) { 8e-29
d2zjrr1110 b.34.5.1 (R:4-113) Ribosomal proteins L24 (L24p) { 8e-27
d2gycs199 b.34.5.1 (S:3-101) Ribosomal proteins L24 (L24p) { 1e-24
d1vqot1119 b.34.5.1 (T:1-119) Ribosomal proteins L24 (L24p) { 3e-17
>d2j01y1 b.34.5.1 (Y:2-102) Ribosomal proteins L24 (L24p) {Thermus thermophilus [TaxId: 274]} Length = 101 Back     information, alignment and structure

class: All beta proteins
fold: SH3-like barrel
superfamily: Translation proteins SH3-like domain
family: Ribosomal proteins L24p and L21e
domain: Ribosomal proteins L24 (L24p)
species: Thermus thermophilus [TaxId: 274]

 Score = 98.6 bits (246), Expect = 8e-29
 Identities = 35/97 (36%), Positives = 55/97 (56%)

Query: 1   MHVKAGDTVKVIAGCDKGKIGEITKVFRHNSTVMVKDINLKTKHVKKREEEEQGQIIKIE 60
           MHVK GDTV V +G  KG++G++ +V      V+V+ +N+  K V+   +  QG  I+ E
Sbjct: 4   MHVKKGDTVLVASGKYKGRVGKVKEVLPKKYAVIVEGVNIVKKAVRVSPKYPQGGFIEKE 63

Query: 61  APIHSSNVMLYSKEMEVASRVGHKVLDDGTRVRYLIK 97
           AP+H+S V          +RV  K L++G ++R   K
Sbjct: 64  APLHASKVRPICPACGKPTRVRKKFLENGKKIRVCAK 100
>d2zjrr1 b.34.5.1 (R:4-113) Ribosomal proteins L24 (L24p) {Deinococcus radiodurans [TaxId: 1299]} Length = 110 Back     information, alignment and structure
>d2gycs1 b.34.5.1 (S:3-101) Ribosomal proteins L24 (L24p) {Escherichia coli [TaxId: 562]} Length = 99 Back     information, alignment and structure
>d1vqot1 b.34.5.1 (T:1-119) Ribosomal proteins L24 (L24p) {Archaeon Haloarcula marismortui [TaxId: 2238]} Length = 119 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query126
d2zjrr1110 Ribosomal proteins L24 (L24p) {Deinococcus radiodu 100.0
d2j01y1101 Ribosomal proteins L24 (L24p) {Thermus thermophilu 100.0
d2gycs199 Ribosomal proteins L24 (L24p) {Escherichia coli [T 100.0
d1vqot1119 Ribosomal proteins L24 (L24p) {Archaeon Haloarcula 99.9
d1nppa258 N-utilization substance G protein NusG, C-terminal 98.05
d1nz9a_58 N-utilization substance G protein NusG, C-terminal 98.01
d2do3a162 Transcription elongation factor SPT5 {Human (Homo 97.22
d2joya196 Ribosomal protein L14e {Sulfolobus solfataricus [T 92.83
d1vhka172 Hypothetical protein YqeU {Bacillus subtilis [TaxI 85.41
d1nxza172 Hypothetical protein HI0303 {Haemophilus influenza 83.55
>d2zjrr1 b.34.5.1 (R:4-113) Ribosomal proteins L24 (L24p) {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
class: All beta proteins
fold: SH3-like barrel
superfamily: Translation proteins SH3-like domain
family: Ribosomal proteins L24p and L21e
domain: Ribosomal proteins L24 (L24p)
species: Deinococcus radiodurans [TaxId: 1299]

Probab=100.00  E-value=3.9e-41  Score=239.79  Aligned_cols=99  Identities=34%  Similarity=0.532  Sum_probs=96.2

Q ss_pred             CCcccCCEEEEeecCCCCeEeEEEEEEccCCeEEEeceeeeEEEecCCcccCCceEEEEeecCcCCCeeeeecCCCCeee
Q 033131            1 MHVKAGDTVKVIAGCDKGKIGEITKVFRHNSTVMVKDINLKTKHVKKREEEEQGQIIKIEAPIHSSNVMLYSKEMEVASR   80 (126)
Q Consensus         1 ~~I~kGD~V~Vi~GkdKGK~G~V~~V~~~~~~V~VeGvN~~kkh~k~~~~~~~ggi~~~e~pI~~SNV~Lv~p~~~~~~r   80 (126)
                      |+|++||+|+||+|+|||++|+|++|++++++|+|||+|++++|+||++++++|||+++|+|||+|||||+||.+++|+|
T Consensus        11 ~kikkGD~V~VisGkdKGk~G~Vl~V~~~~~~ViVeGvN~~kkh~Kp~~~~~~Ggiv~~E~PIhiSNV~lvdp~~~k~tr   90 (110)
T d2zjrr1          11 LHFKKGDTVIVLSGKHKGQTGKVLLALPRDQKVVVEGVNVITKNVKPSMTNPQGGQEQRELALHASKVALVDPETGKATR   90 (110)
T ss_dssp             CSSCTTSEEECCSSSSTTCEEEEEEEETTTTEEEESSSCBCCCCCCTTSSSCCCCCCCBCCCBCSSSEECBSSSSBCCCC
T ss_pred             eeeeCCCEEEEeecCCCCcceEEEEEECCCCEEEEeCcEEEEEEecccccCCCCCeEeeeeeEEhhhEEEEcCCCCCceE
Confidence            68999999999999999999999999999999999999999999999988889999999999999999999999999999


Q ss_pred             EEEEEccCCcEEEEEcccCc
Q 033131           81 VGHKVLDDGTRVRYLIKTGE  100 (126)
Q Consensus        81 v~~~~~~dG~kvRv~k~sg~  100 (126)
                      |+|++ +||+++|||++||+
T Consensus        91 v~~~~-~dGkKvRv~kksGe  109 (110)
T d2zjrr1          91 VRKQI-VDGKKVRVAVASGK  109 (110)
T ss_dssp             CCCCC-SCTTSCCCCSSSCC
T ss_pred             EEEEE-eCCeEEEEEecCCC
Confidence            99986 78999999999997
>d2j01y1 b.34.5.1 (Y:2-102) Ribosomal proteins L24 (L24p) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2gycs1 b.34.5.1 (S:3-101) Ribosomal proteins L24 (L24p) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vqot1 b.34.5.1 (T:1-119) Ribosomal proteins L24 (L24p) {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1nppa2 b.34.5.4 (A:191-248) N-utilization substance G protein NusG, C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1nz9a_ b.34.5.4 (A:) N-utilization substance G protein NusG, C-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2do3a1 b.34.5.5 (A:462-523) Transcription elongation factor SPT5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2joya1 b.34.5.7 (A:1-96) Ribosomal protein L14e {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1vhka1 b.122.1.2 (A:2-73) Hypothetical protein YqeU {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1nxza1 b.122.1.2 (A:2-73) Hypothetical protein HI0303 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure