Citrus Sinensis ID: 033136


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120------
MASCNMASAASGFSLTPNVATNVNSGSKSNMLFFPPKNNSSNSFRLVVRASEEAAAPPAAATTAAPAEGEAAPKPKPPPIGPKRGAKVKILRRESYWYNGIGSVVAVDQVRLFSIFLVYVTFNHFK
ccccccccccccCEEccccccccccccccCEEEEcccccccccCEEEEEcccccccccccccccccccccccccccccccccccccEEEEEEEccEEEccccEEEEEccccccEEEEEEEEEcccc
**********SGFSLTPN*********************************************************************VKILRRESYWYNGIGSVVAVDQVRLFSIFLVYVTFNH**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASCNMASAASGFSLTPNVATNVNSGSKSNMLFFPPKNNSSNSFRLVVRASEEAAAPPAAATTAAPAEGEAAPKPKPPPIGPKRGAKVKILRRESYWYNGIGSVVAVDQVRLFSIFLVYVTFNHFK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Photosystem I reaction center subunit IV B, chloroplastic Stabilizes the interaction between psaC and the PSI core, assists the docking of the ferredoxin to PSI and interacts with ferredoxin-NADP oxidoreductase.probableQ9S714

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2WSC, chain E
Confidence level:very confident
Coverage over the Query: 80-126
View the alignment between query and template
View the model in PyMOL