Citrus Sinensis ID: 033140


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120------
MSLSLQGCHRLRGRRAGSSLYLDVHIVVDPFSSVSAAHGVGENVRHQIHKSHPEVSEVFIHIDPAYFQFSPSTMDQLGLEGCKAHSSNICVDDLDIDAVVYNTLSTKFPEVANRDLWATHSLAFDY
ccccccccccccECccccEEEEEEEEEEcccccHHHHHHHHHHHHHHHHHHcccccEEEEEccccccccccccccccccccHHHHccccccccccccHHccccccccccccccHHHHHHHHccccc
MSLSLQGCHRLRGRRAGSSLYLDVHIVVDPFSSVSAAHGVGENVRHQIHKSHPEVSEVFIHIDPAYFQFSPSTMDQLGLEGCKAHSSNICVDDLDIDAVVYNTLSTKFPEVANRDLWATHSLAFDY
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSLSLQGCHRLRGRRAGSSLYLDVHIVVDPFSSVSAAHGVGENVRHQIHKSHPEVSEVFIHIDPAYFQFSPSTMDQLGLEGCKAHSSNICVDDLDIDAVVYNTLSTKFPEVANRDLWATHSLAFDY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Metal tolerance protein 2 Involved in sequestration of excess metal in the cytoplasm into vacuoles to maintain metal homeostasis.probableQ10LJ2

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2ZZT, chain A
Confidence level:very confident
Coverage over the Query: 2-67
View the alignment between query and template
View the model in PyMOL
Template: 1GHH, chain A
Confidence level:probable
Coverage over the Query: 21-106
View the alignment between query and template
View the model in PyMOL