Citrus Sinensis ID: 033147


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120------
MMHQICWYFTESWDQFRINGRVDVIDGSNSDPEKLQIREKSWFGCSMKARLQYLDPEQGCPSVNEQPKEFSLDPCAGPVDAFCVLILDPDQVDYLNLKSNQKLKFMSRLSDNGEKYWASLKTSPEC
cEEEEEEEEccccEEEEEEEEEEEEccccccHHHHHHHHHHHHHccHHHHHccccccccccccccccccccccccccccccEEEEEEcccCEEEEEcccccEEEEEEEcccccccccEEEEccccc
MMHQICWYFTESWDQFRINGRVDVIDGSNSDPEKLQIREKSWFGCSMKARLQYLDPE************FS**PCAGPVDAFCVLILDPDQVDYLNLKSNQKLKFMSRLSDNGEKYWASLKTSP**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMHQICWYFTESWDQFRINGRVDVIDGSNSDPEKLQIREKSWFGCSMKARLQYLDPEQGCPSVNEQPKEFSLDPCAGPVDAFCVLILDPDQVDYLNLKSNQKLKFMSRLSDNGEKYWASLKTSPEC

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Pyridoxine/pyridoxamine 5'-phosphate oxidase 2 Catalyzes the oxidation of either pyridoxine 5'-phosphate (PNP) or pyridoxamine 5'-phosphate (PMP) into pyridoxal 5'-phosphate (PLP). Has an in vitro catalytic efficiency for PNP approximately 300-fold lower than that of PPOX1.probableQ9ZPY1

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2I51, chain A
Confidence level:very confident
Coverage over the Query: 2-124
View the alignment between query and template
View the model in PyMOL