Citrus Sinensis ID: 033156


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120------
MMVRFKMYNSFGFKSLAAMLLFFILSISISYRASAETTMHTNNWAVLVCTSRFWFNYRHMANTLSLYRTVKRLGVPDERIILMLADDMACNARNKYPAQVFNNENHKLNLYGDNVEVGTVFSRYSA
ccEEEEcccHHHHHHHHHHHHHHHHHHHHHHccccccccccccEEEEEEccccccccccccHHHHHHHHHHHcccccccEEEEcccccccccccccccEEEEccccccccccccCECccEEEEccc
***RFKMYNSFGFKSLAAMLLFFILSISISYRAS****MHTNNWAVLVCTSRFWFNYRHMANTLSLYRTVKRLGVPDERIILMLADDMACNARNKYPAQVFNNENHKLNLYGDNVEVGTVFSRYSA
xxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMVRFKMYNSFGFKSLAAMLLFFILSISISYRASAETTMHTNNWAVLVCTSRFWFNYRHMANTLSLYRTVKRLGVPDERIILMLADDMACNARNKYPAQVFNNENHKLNLYGDNVEVGTVFSRYSA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
GPI-anchor transamidase Mediates GPI anchoring in the endoplasmic reticulum, by replacing a protein's C-terminal GPI attachment signal peptide with a pre-assembled GPI. During this transamidation reaction, the GPI transamidase forms a carbonyl intermediate with the substrate protein.probableP49018
GPI-anchor transamidase Mediates GPI anchoring in the endoplasmic reticulum, by replacing a protein's C-terminal GPI attachment signal peptide with a pre-assembled GPI. During this transamidation reaction, the GPI transamidase forms a carbonyl intermediate with the substrate protein.probableQ9CXY9
GPI-anchor transamidase Mediates GPI anchoring in the endoplasmic reticulum, by replacing a protein's C-terminal GPI attachment signal peptide with a pre-assembled GPI. During this transamidation reaction, the GPI transamidase forms a carbonyl intermediate with the substrate protein.probableQ3MHZ7

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4AF8, chain A
Confidence level:probable
Coverage over the Query: 37-86
View the alignment between query and template
View the model in PyMOL