Citrus Sinensis ID: 033167

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-----

MNKKEIFKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRNAFPGNKNIVHPPRKADISINA

cHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHcccHHHHHHHHHHHHccHHHHHHHHHHHHHHcccccccccccccccccccc

*NKKEIFKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRNAFP******************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MNKKEIFKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRQHGVNYGNFMHGLMKENIQLNRKVLSELSMHEPYSFKALVDISRNAFPGNKNIVHPPRKADISINA

Annotation	Function Description	Confidence Level	Reference Protein
50S ribosomal protein L20	Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.	probable	Q5HC39
50S ribosomal protein L20	Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.	probable	Q3YSX0
50S ribosomal protein L20	Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.	probable	A9W371

No EC number assigned to the protein, probably not an enzyme!

Template: 2GHJ, chain A
Confidence level:very confident
Coverage over the Query: 24-106
View the alignment between query and template
View the model in PyMOL