Citrus Sinensis ID: 033171

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-----
MEDQTELVGKTFVGHYYHLFDNDRASLSSLYQPTSMLTFEGQKFFGVDDISTKFNQLPFDQCRHMISTIDSQPCPSTGGLLIFVSGSLQLAGEDHHLRFSQMFHLIPTPRGSFAVQNDIFRLNYG
cccHHHHHHHHHHHHHHHHHcccHHHHHcccccccEEEEcccEEEcHHHHHHHHcccccccEEEEEEEEEEEEccccccEEEEEEEEEEEccccccccEEEEEEEEEcccccEEEEccEEEEEcc
**DQTELVGKTFVGHYYHLFDNDRASLSSLYQPTSMLTFEGQKFFGVDDISTKFNQLPFDQCRHMISTIDSQPCPSTGGLLIFVSGSLQLAGEDHHLRFSQMFHLIPTPRGSFAVQNDIFRLNYG
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEDQTELVGKTFVGHYYHLFDNDRASLSSLYQPTSMLTFEGQKFFGVDDISTKFNQLPFDQCRHMISTIDSQPCPSTGGLLIFVSGSLQLAGEDHHLRFSQMFHLIPTPRGSFAVQNDIFRLNYG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Nuclear transport factor 2 Facilitates protein transport into the nucleus. Interacts with the nucleoporin p62 and with Ran. Acts at a relatively late stage of nuclear protein import, subsequent to the initial docking of nuclear import ligand at the nuclear envelope. Could be part of a multicomponent system of cytosolic factors that assemble at the pore complex during nuclear import.probableP61972
Nuclear transport factor 2 Facilitates protein transport into the nucleus. Interacts with the nucleoporin p62 and with Ran. Acts at a relatively late stage of nuclear protein import, subsequent to the initial docking of nuclear import ligand at the nuclear envelope. Could be part of a multicomponent system of cytosolic factors that assemble at the pore complex during nuclear import.probableP61971
Nuclear transport factor 2 Facilitates protein transport into the nucleus. Interacts with the nucleoporin p62 and with Ran. Acts at a relatively late stage of nuclear protein import, subsequent to the initial docking of nuclear import ligand at the nuclear envelope. Could be part of a multicomponent system of cytosolic factors that assemble at the pore complex during nuclear import.probableP61970

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1GY7, chain A
Confidence level:very confident
Coverage over the Query: 4-125
View the alignment between query and template
View the model in PyMOL