Citrus Sinensis ID: 033171

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-----
MEDQTELVGKTFVGHYYHLFDNDRASLSSLYQPTSMLTFEGQKFFGVDDISTKFNQLPFDQCRHMISTIDSQPCPSTGGLLIFVSGSLQLAGEDHHLRFSQMFHLIPTPRGSFAVQNDIFRLNYG
cccHHHHHHHHHHHHHHHHHcccHHHHHcccccccEEEEcccEEEcHHHHHHHHcccccccEEEEEEEEEEEEccccccEEEEEEEEEEEccccccccEEEEEEEEEcccccEEEEccEEEEEcc
ccccHHHHHHHHHHHHHHHHHHHHHHcHHHEEEEEEEEEccEEEEcHHHHHHHHHHcccccEEEEEEEEEEEEccccccEEEEEEEEEEEccccccEEEEEEEEEEEccccEEEEEEEEEEEEcc
MEDQTELVGKTFVGHyyhlfdndraslsslyqptsmltfegqkffgvddistkfnqlpfdqcrhmistidsqpcpstgglLIFVSGslqlagedhhLRFSQmfhliptprgsfavqnDIFRLNYG
MEDQTELVGKTFVGHYYHLFDNDRASLSSLYQPTSMLTFEGQKFFGVDDISTKFNQLPFDQCRHMISTIDSQPCPSTGGLLIFVSGSLQLAGEDHHLRFSQMFHLIPtprgsfavqNDIFRLNYG
MEDQTELVGKTFVGHYYHLFDNDRASLSSLYQPTSMLTFEGQKFFGVDDISTKFNQLPFDQCRHMISTIDSQPCPSTGGLLIFVSGSLQLAGEDHHLRFSQMFHLIPTPRGSFAVQNDIFRLNYG
******LVGKTFVGHYYHLFDNDRASLSSLYQPTSMLTFEGQKFFGVDDISTKFNQLPFDQCRHMISTIDSQPCPSTGGLLIFVSGSLQLAGEDHHLRFSQMFHLIPTPRGSFAVQNDIFRL***
**DQTELVGKTFVGHYYHLFDNDRASLSSLYQPTSMLTFEGQKFFGVDDISTKFNQLPFDQCRHMISTIDSQPCPSTGGLLIFVSGSLQLAGEDHHLRFSQMFHLIPTPRGSFAVQNDIFRLNYG
MEDQTELVGKTFVGHYYHLFDNDRASLSSLYQPTSMLTFEGQKFFGVDDISTKFNQLPFDQCRHMISTIDSQPCPSTGGLLIFVSGSLQLAGEDHHLRFSQMFHLIPTPRGSFAVQNDIFRLNYG
MEDQTELVGKTFVGHYYHLFDNDRASLSSLYQPTSMLTFEGQKFFGVDDISTKFNQLPFDQCRHMISTIDSQPCPSTGGLLIFVSGSLQLAGEDHHLRFSQMFHLIPTPRGSFAVQNDIFRLNYG
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEDQTELVGKTFVGHYYHLFDNDRASLSSLYQPTSMLTFEGQKFFGVDDISTKFNQLPFDQCRHMISTIDSQPCPSTGGLLIFVSGSLQLAGEDHHLRFSQMFHLIPTPRGSFAVQNDIFRLNYG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query125 2.2.26 [Sep-21-2011]
Q9C7F5126 Nuclear transport factor no no 0.96 0.952 0.625 4e-39
Q9XJ54122 Nuclear transport factor no no 0.96 0.983 0.561 6e-33
Q9P926124 Nuclear transport factor N/A no 0.936 0.943 0.474 7e-25
Q10100123 Nuclear transport factor yes no 0.936 0.951 0.457 2e-24
Q8NJ52125 Nuclear transport factor N/A no 0.928 0.928 0.418 5e-23
Q6BWC0124 Nuclear transport factor yes no 0.936 0.943 0.466 6e-23
P33331125 Nuclear transport factor yes no 0.936 0.936 0.449 7e-23
Q75AA5125 Nuclear transport factor yes no 0.936 0.936 0.440 8e-23
Q6CQX4125 Nuclear transport factor yes no 0.936 0.936 0.440 1e-22
Q96VN3125 Nuclear transport factor yes no 0.936 0.936 0.427 2e-22
>sp|Q9C7F5|NTF2_ARATH Nuclear transport factor 2 OS=Arabidopsis thaliana GN=NTF2 PE=2 SV=1 Back     alignment and function desciption
 Score =  159 bits (403), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 75/120 (62%), Positives = 87/120 (72%)

Query: 6   ELVGKTFVGHYYHLFDNDRASLSSLYQPTSMLTFEGQKFFGVDDISTKFNQLPFDQCRHM 65
           + V K FV HYY  FD +R  L+ LYQ  SMLTFEGQK  GV  I  K   LPF QC+H 
Sbjct: 7   DAVSKAFVEHYYSTFDTNRVGLAGLYQEASMLTFEGQKIQGVQSIVAKLTSLPFQQCKHH 66

Query: 66  ISTIDSQPCPSTGGLLIFVSGSLQLAGEDHHLRFSQMFHLIPTPRGSFAVQNDIFRLNYG 125
           IST+D QP     G+L+FVSG+LQLAGE+H L+FSQMFHL+PTP+GSF V NDIFRLNY 
Sbjct: 67  ISTVDCQPSGPASGMLVFVSGNLQLAGEEHALKFSQMFHLMPTPQGSFYVFNDIFRLNYA 126
Facilitates protein transport into the nucleus. Could be part of a multicomponent system of cytosolic factors that assemble at the pore complex during nuclear import.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9XJ54|NTF2_ORYSJ Nuclear transport factor 2 OS=Oryza sativa subsp. japonica GN=NTF2 PE=2 SV=1 Back     alignment and function description
>sp|Q9P926|NTF2_CANAX Nuclear transport factor 2 OS=Candida albicans GN=NTF2 PE=3 SV=1 Back     alignment and function description
>sp|Q10100|NTF2_SCHPO Nuclear transport factor 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ntf2 PE=3 SV=2 Back     alignment and function description
>sp|Q8NJ52|NTF2_DAVTA Nuclear transport factor 2 OS=Davidiella tassiana GN=NTF2 PE=1 SV=1 Back     alignment and function description
>sp|Q6BWC0|NTF2_DEBHA Nuclear transport factor 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=NTF2 PE=3 SV=1 Back     alignment and function description
>sp|P33331|NTF2_YEAST Nuclear transport factor 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NTF2 PE=1 SV=2 Back     alignment and function description
>sp|Q75AA5|NTF2_ASHGO Nuclear transport factor 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=NTF2 PE=3 SV=1 Back     alignment and function description
>sp|Q6CQX4|NTF2_KLULA Nuclear transport factor 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=NTF2 PE=3 SV=1 Back     alignment and function description
>sp|Q96VN3|NTF2_EMENI Nuclear transport factor 2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ntf2 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query125
255554973125 nuclear transport factor, putative [Rici 1.0 1.0 0.736 2e-49
224116096123 predicted protein [Populus trichocarpa] 0.984 1.0 0.731 3e-47
225444371125 PREDICTED: nuclear transport factor 2 [V 1.0 1.0 0.712 4e-46
449454716132 PREDICTED: nuclear transport factor 2-li 1.0 0.946 0.664 4e-45
449472651125 PREDICTED: nuclear transport factor 2-li 1.0 1.0 0.664 4e-45
297843986 469 T23J18.22 [Arabidopsis lyrata subsp. lyr 0.96 0.255 0.707 5e-45
238478440132 nuclear transport factor 2-like protein 0.96 0.909 0.699 3e-43
6554189 522 T23J18.22 [Arabidopsis thaliana] 0.952 0.227 0.696 3e-43
449533455119 PREDICTED: nuclear transport factor 2-li 0.952 1.0 0.647 3e-41
116783077123 unknown [Picea sitchensis] 0.96 0.975 0.658 2e-40
>gi|255554973|ref|XP_002518524.1| nuclear transport factor, putative [Ricinus communis] gi|223542369|gb|EEF43911.1| nuclear transport factor, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  199 bits (506), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 92/125 (73%), Positives = 106/125 (84%)

Query: 1   MEDQTELVGKTFVGHYYHLFDNDRASLSSLYQPTSMLTFEGQKFFGVDDISTKFNQLPFD 60
           ME+Q E VGK FV HYY+LFDNDR+SL+SLY P+SMLTFEGQK  GVDDIS+K N LPFD
Sbjct: 1   MEEQVETVGKAFVNHYYNLFDNDRSSLASLYHPSSMLTFEGQKILGVDDISSKLNNLPFD 60

Query: 61  QCRHMISTIDSQPCPSTGGLLIFVSGSLQLAGEDHHLRFSQMFHLIPTPRGSFAVQNDIF 120
           QC+H ISTID+QP    GG+++FVSGSLQLAGE+H LRFSQMFHLIP+ +G   VQNDIF
Sbjct: 61  QCKHAISTIDTQPSSFAGGIVVFVSGSLQLAGEEHPLRFSQMFHLIPSVQGGLFVQNDIF 120

Query: 121 RLNYG 125
           RLNYG
Sbjct: 121 RLNYG 125

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224116096|ref|XP_002317209.1| predicted protein [Populus trichocarpa] gi|222860274|gb|EEE97821.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225444371|ref|XP_002267081.1| PREDICTED: nuclear transport factor 2 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449454716|ref|XP_004145100.1| PREDICTED: nuclear transport factor 2-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449472651|ref|XP_004153658.1| PREDICTED: nuclear transport factor 2-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|297843986|ref|XP_002889874.1| T23J18.22 [Arabidopsis lyrata subsp. lyrata] gi|297335716|gb|EFH66133.1| T23J18.22 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|238478440|ref|NP_001154326.1| nuclear transport factor 2-like protein [Arabidopsis thaliana] gi|332190632|gb|AEE28753.1| nuclear transport factor 2-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|6554189|gb|AAF16635.1|AC011661_13 T23J18.22 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449533455|ref|XP_004173691.1| PREDICTED: nuclear transport factor 2-like, partial [Cucumis sativus] Back     alignment and taxonomy information
>gi|116783077|gb|ABK22785.1| unknown [Picea sitchensis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query125
TAIR|locus:2200066132 NTL "NTF2-like" [Arabidopsis t 0.96 0.909 0.699 4.5e-43
TAIR|locus:2010509134 NTF2B "AT1G27970" [Arabidopsis 0.92 0.858 0.617 8.3e-35
TAIR|locus:2015914122 NTF2A "AT1G27310" [Arabidopsis 0.944 0.967 0.596 1.1e-32
POMBASE|SPAC15F9.03c123 nxt2 "nuclear transport factor 0.984 1.0 0.456 1.4e-23
SGD|S000000811125 NTF2 "Nuclear envelope protein 0.928 0.928 0.452 1.3e-22
ASPGD|ASPL0000071333125 ntfA [Emericella nidulans (tax 0.936 0.936 0.427 9e-22
UNIPROTKB|F1S2K3127 LOC100621711 "Uncharacterized 0.936 0.921 0.414 1.7e-18
GENEDB_PFALCIPARUM|PF14_0122125 PF14_0122 "nuclear transport f 0.944 0.944 0.380 2.2e-18
UNIPROTKB|Q32KP9127 NUTF2 "Nuclear transport facto 0.936 0.921 0.414 2.2e-18
UNIPROTKB|P61970127 NUTF2 "Nuclear transport facto 0.936 0.921 0.414 2.2e-18
TAIR|locus:2200066 NTL "NTF2-like" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 455 (165.2 bits), Expect = 4.5e-43, P = 4.5e-43
 Identities = 86/123 (69%), Positives = 98/123 (79%)

Query:     6 ELVGKTFVGHYYHLFDNDRASLSSLYQPTSMLTFEGQKFFGVDDISTKFNQLPFDQCRHM 65
             E V   FV HYYHLFDNDR+SLSSLY PTS+LTFEGQ  +GVD+IS K  QLPFDQC H+
Sbjct:    10 EEVASAFVNHYYHLFDNDRSSLSSLYNPTSLLTFEGQTIYGVDNISNKLKQLPFDQCHHL 69

Query:    66 ISTIDSQPCPSTGG---LLIFVSGSLQLAGEDHHLRFSQMFHLIPTPRGSFAVQNDIFRL 122
             IST+DSQP    GG   +L+FVSGS+QL GEDH LRFSQ FHLIP  +GSF VQN++FRL
Sbjct:    70 ISTVDSQPSSMAGGCGGILVFVSGSIQLHGEDHPLRFSQTFHLIPVLQGSFFVQNEMFRL 129

Query:   123 NYG 125
             NYG
Sbjct:   130 NYG 132
GO:0005622 "intracellular" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISS
GO:0005737 "cytoplasm" evidence=ISM
GO:0006606 "protein import into nucleus" evidence=ISS
GO:0006810 "transport" evidence=IEA
GO:0008565 "protein transporter activity" evidence=ISS
TAIR|locus:2010509 NTF2B "AT1G27970" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2015914 NTF2A "AT1G27310" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
POMBASE|SPAC15F9.03c nxt2 "nuclear transport factor Nxt2" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
SGD|S000000811 NTF2 "Nuclear envelope protein" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
ASPGD|ASPL0000071333 ntfA [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
UNIPROTKB|F1S2K3 LOC100621711 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
GENEDB_PFALCIPARUM|PF14_0122 PF14_0122 "nuclear transport factor 2, putative" [Plasmodium falciparum (taxid:5833)] Back     alignment and assigned GO terms
UNIPROTKB|Q32KP9 NUTF2 "Nuclear transport factor 2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P61970 NUTF2 "Nuclear transport factor 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q6BWC0NTF2_DEBHANo assigned EC number0.46610.9360.9435yesno
Q6CC82NTF2_YARLINo assigned EC number0.47000.9120.9268yesno
P61972NTF2_RATNo assigned EC number0.41460.9360.9212yesno
P61971NTF2_MOUSENo assigned EC number0.41460.9360.9212yesno
P61970NTF2_HUMANNo assigned EC number0.41460.9360.9212yesno
Q6CQX4NTF2_KLULANo assigned EC number0.44060.9360.936yesno
Q10100NTF2_SCHPONo assigned EC number0.45760.9360.9512yesno
Q21735NTF2_CAEELNo assigned EC number0.41930.9280.8721yesno
Q86HW7NTF2_DICDINo assigned EC number0.43100.9040.8897yesno
Q75AA5NTF2_ASHGONo assigned EC number0.44060.9360.936yesno
P33331NTF2_YEASTNo assigned EC number0.44910.9360.936yesno
Q32KP9NTF2_BOVINNo assigned EC number0.41460.9360.9212yesno
Q6FRC6NTF2_CANGANo assigned EC number0.44060.9360.936yesno
Q96VN3NTF2_EMENINo assigned EC number0.42730.9360.936yesno
Q5R8G4NTF2_PONABNo assigned EC number0.41880.9120.8976yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer5.3.3.1LOW CONFIDENCE prediction!
3rd Layer5.3.3LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query125
cd00780119 cd00780, NTF2, Nuclear transport factor 2 (NTF2) d 2e-37
pfam02136116 pfam02136, NTF2, Nuclear transport factor 2 (NTF2) 8e-30
cd00531124 cd00531, NTF2_like, Nuclear transport factor 2 (NT 5e-17
>gnl|CDD|238403 cd00780, NTF2, Nuclear transport factor 2 (NTF2) domain plays an important role in the trafficking of macromolecules, ions and small molecules between the cytoplasm and nucleus Back     alignment and domain information 
 Score =  122 bits (308), Expect = 2e-37
 Identities = 58/120 (48%), Positives = 73/120 (60%), Gaps = 4/120 (3%)

Query: 6   ELVGKTFVGHYYHLFDNDRASLSSLYQPTSMLTFEGQKFF-GVDDISTKFNQLPFDQCRH 64
           E V K FV  YY +FDN+R  L  LY  TSML+ EG K   G D I  K + LPF + +H
Sbjct: 3   EDVAKAFVQQYYSIFDNNREGLHRLYGDTSMLSREGMKQVTGRDAIVEKLSSLPFQKTKH 62

Query: 65  MISTIDSQPCPSTGGLLIFVSGSLQLAGEDHHLRFSQMFHLIPTPRGSFAVQNDIFRLNY 124
            I+T+DSQP PS GG+++ V+GSL+L  E    +FSQ F L P   G + V NDIFR   
Sbjct: 63  KITTVDSQPTPS-GGVIVMVTGSLKL-DEQPPRKFSQTFVLAPQN-GGYFVLNDIFRFVD 119

This bi-directional transport of macromolecules across the nuclear envelope requires many soluble factors that includes GDP-binding protein Ran (RanGDP). RanGDP is required for both import and export of proteins and poly(A) RNA. RanGDP also has been implicated in cell cycle control, specifically in mitotic spindle assembly. In interphase cells, RanGDP is predominately nuclear and thought to be GTP bound, but it is also present in the cytoplasm, probably in the GDP-bound state. NTF2 mediates the nuclear import of RanGDP. NTF2 binds to both RanGDP and FxFG repeat-containing nucleoporins. Length = 119
>gnl|CDD|216894 pfam02136, NTF2, Nuclear transport factor 2 (NTF2) domain Back     alignment and domain information
>gnl|CDD|238296 cd00531, NTF2_like, Nuclear transport factor 2 (NTF2-like) superfamily Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 125
KOG2104126 consensus Nuclear transport factor 2 [Intracellula 100.0
cd00780119 NTF2 Nuclear transport factor 2 (NTF2) domain play 100.0
PF02136118 NTF2: Nuclear transport factor 2 (NTF2) domain; In 100.0
KOG4353139 consensus RNA export factor NXT1 [RNA processing a 100.0
KOG0116 419 consensus RasGAP SH3 binding protein rasputin, con 99.97
PF10429166 Mtr2: Nuclear pore RNA shuttling protein Mtr2; Int 99.62
KOG3763585 consensus mRNA export factor TAP/MEX67 [RNA proces 99.3
cd00531124 NTF2_like Nuclear transport factor 2 (NTF2-like) s 99.28
TIGR02246128 conserved hypothetical protein. This family consis 98.21
PF15008262 DUF4518: Domain of unknown function (DUF4518) 98.06
PF13474121 SnoaL_3: SnoaL-like domain; PDB: 2GXF_A 3KSP_A 3KE 98.02
PF14534107 DUF4440: Domain of unknown function (DUF4440); PDB 97.65
PF12680102 SnoaL_2: SnoaL-like domain; PDB: 3F40_A 3RGA_A 3G8 97.26
cd00781122 ketosteroid_isomerase ketosteroid isomerase: Many 96.79
PF12893116 Lumazine_bd_2: Putative lumazine-binding; PDB: 3BL 96.72
PF08332128 CaMKII_AD: Calcium/calmodulin dependent protein ki 96.64
PF13577127 SnoaL_4: SnoaL-like domain; PDB: 3S5C_B 3EJV_A 2RF 96.52
COG4875156 Uncharacterized protein conserved in bacteria with 92.6
COG4319137 Ketosteroid isomerase homolog [Function unknown] 92.54
TIGR02096129 conserved hypothetical protein, steroid delta-isom 89.45
>KOG2104 consensus Nuclear transport factor 2 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information 
Probab=100.00  E-value=2.8e-44  Score=235.55  Aligned_cols=122  Identities=53%  Similarity=0.867  Sum_probs=117.3

Q ss_pred             CCCCHHHHHHHHHHHHhhccccChhhhcccccCCceEEEcCceecCHHHHHHHHhcCCCCcceEEeEEeeeeecCCCCcE
Q 033171            1 MEDQTELVGKTFVGHYYHLFDNDRASLSSLYQPTSMLTFEGQKFFGVDDISTKFNQLPFDQCRHMISTIDSQPCPSTGGL   80 (125)
Q Consensus         1 ~~~~~~~i~~~Fv~~YY~~l~~~r~~L~~~Y~~~S~~t~~g~~~~G~~~I~~~l~~lp~~~~~~~i~s~D~q~~~~~~~i   80 (125)
                      |++.++.+|+.|+++||.+||.+|+.|..+|.+.|+|||+|+.++|+++|.+||.+|||++++|.|+++||||+ ++|||
T Consensus         2 ~d~~~e~v~~~FvqhYY~~FD~dR~ql~~lY~~~S~LTfEGqq~qG~~~IveKl~sLpFqkiqh~IttvD~QPt-~~g~i   80 (126)
T KOG2104|consen    2 LDPVYEAVAKAFVQHYYSLFDNDRSQLGALYIDTSMLTFEGQQIQGKDAIVEKLTSLPFQKIQHSITTVDSQPT-PDGGI   80 (126)
T ss_pred             CCccHHHHHHHHHHHHHHHhcCchhHhhhhhcccceeeEcchhhcchHHHHHHHhcCChhhhhceeeecccccC-CCCcE
Confidence            46678999999999999999999999999999999999999999999999999999999999999999999999 99999


Q ss_pred             EEEEEEEEEEcCCCCceeeEEEEEEeeCCCCcEEEEceeEEeec
Q 033171           81 LIFVSGSLQLAGEDHHLRFSQMFHLIPTPRGSFAVQNDIFRLNY  124 (125)
Q Consensus        81 lI~V~G~~~~~~~~~~~~F~qtF~L~~~~~~~y~I~nD~fr~~~  124 (125)
                      +|+|.|+++.++++ +.+|+|.|.|.|+.+|+||+.|||||+.+
T Consensus        81 lv~V~G~Lk~dEd~-~~~FsQvF~L~~n~~~~~~v~ndiFRLn~  123 (126)
T KOG2104|consen   81 LVMVVGQLKLDEDP-ILRFSQVFLLKPNIQGSYYVFNDIFRLNL  123 (126)
T ss_pred             EEEEeeeeeeccCC-ccceeeEEEEeEcCCCCEEEEeeeEEEec
Confidence            99999999999775 99999999999997799999999999975

>cd00780 NTF2 Nuclear transport factor 2 (NTF2) domain plays an important role in the trafficking of macromolecules, ions and small molecules between the cytoplasm and nucleus Back     alignment and domain information
>PF02136 NTF2: Nuclear transport factor 2 (NTF2) domain; InterPro: IPR002075 Nuclear transport factor 2 (NTF2) is a homodimer which stimulates efficient nuclear import of a cargo protein Back     alignment and domain information
>KOG4353 consensus RNA export factor NXT1 [RNA processing and modification] Back     alignment and domain information
>KOG0116 consensus RasGAP SH3 binding protein rasputin, contains NTF2 and RRM domains [Signal transduction mechanisms] Back     alignment and domain information
>PF10429 Mtr2: Nuclear pore RNA shuttling protein Mtr2; InterPro: IPR019488 Mtr2 is a monomeric, dual-action, RNA-shuttle protein found in yeasts Back     alignment and domain information
>KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification] Back     alignment and domain information
>cd00531 NTF2_like Nuclear transport factor 2 (NTF2-like) superfamily Back     alignment and domain information
>TIGR02246 conserved hypothetical protein Back     alignment and domain information
>PF15008 DUF4518: Domain of unknown function (DUF4518) Back     alignment and domain information
>PF13474 SnoaL_3: SnoaL-like domain; PDB: 2GXF_A 3KSP_A 3KE7_A 3BB9_E 3CNX_A 3F7S_A 3GWR_B Back     alignment and domain information
>PF14534 DUF4440: Domain of unknown function (DUF4440); PDB: 3HX8_A 3SOY_A 3ROB_B 3GZR_A 3B7C_A 3CU3_A 3FSD_A 2R4I_C 1TP6_A Back     alignment and domain information
>PF12680 SnoaL_2: SnoaL-like domain; PDB: 3F40_A 3RGA_A 3G8Z_A 3DMC_A 3FH1_A 1TUH_A 3F14_A 3ER7_A 1Z1S_A 3F7X_A Back     alignment and domain information
>cd00781 ketosteroid_isomerase ketosteroid isomerase: Many biological reactions proceed by enzymatic cleavage of a C-H bond adjacent to carbonyl or a carboxyl group, leading to an enol or a enolate intermediate that is subsequently re-protonated at the same or an adjacent carbon Back     alignment and domain information
>PF12893 Lumazine_bd_2: Putative lumazine-binding; PDB: 3BLZ_C 3DUK_F 3FKA_C Back     alignment and domain information
>PF08332 CaMKII_AD: Calcium/calmodulin dependent protein kinase II Association; InterPro: IPR013543 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>PF13577 SnoaL_4: SnoaL-like domain; PDB: 3S5C_B 3EJV_A 2RFR_A 3B8L_F 2CHC_A 3A76_A 3EF8_B Back     alignment and domain information
>COG4875 Uncharacterized protein conserved in bacteria with a cystatin-like fold [Function unknown] Back     alignment and domain information
>COG4319 Ketosteroid isomerase homolog [Function unknown] Back     alignment and domain information
>TIGR02096 conserved hypothetical protein, steroid delta-isomerase-related Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query125
1gy7_A125 N77y Point Mutant Of S.Cerevisiae Ntf2 Length = 125 1e-23
1zo2_A129 Structure Of Nuclear Transport Factor 2 (Ntf2) From 3e-23
1oun_A127 Crystal Structure Of Nuclear Transport Factor 2 (Nt 7e-19
1qma_A126 Nuclear Transport Factor 2 (Ntf2) W7a Mutant Length 8e-19
1jb2_A127 Crystal Structure Of Ntf2 M84e Mutant Length = 127 1e-18
1jb5_A127 Crystal Structure Of Ntf2 M118e Mutant Length = 127 1e-18
1gy5_A127 D92n,D94n Double Point Mutant Of Human Nuclear Tran 2e-18
1ar0_A127 Nuclear Transport Factor 2 (Ntf2) E42k Mutant Lengt 2e-18
1jb4_A127 Crystal Structure Of Ntf2 M102e Mutant Length = 127 3e-18
1u5o_A127 Structure Of The D23a Mutant Of The Nuclear Transpo 6e-18
1ask_A127 Nuclear Transport Factor 2 (Ntf2) H66a Mutant Lengt 7e-18
3ujm_A120 Crystal Structure Of The Ntf2-Like Domain Of The Dr 2e-08
1jkg_A140 Structural Basis For The Recognition Of A Nucleopor 2e-08
3nv0_B154 Crystal Structure And Mutational Analysis Of The Nx 6e-08
>pdb|1GY7|A Chain A, N77y Point Mutant Of S.Cerevisiae Ntf2 Length = 125 Back     alignment and structure 
Iteration: 1

 Score =  104 bits (260), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 53/118 (44%), Positives = 73/118 (61%), Gaps = 1/118 (0%)
Query: 8   VGKTFVGHYYHLFDNDRASLSSLYQPTSMLTFEGQKFFGVDDISTKFNQLPFDQCRHMIS 67
           + + F   YY+ FD DR+ L +LY+  SMLTFE  +  G  DI  K   LPF + +H I+
Sbjct: 8   LAQNFTQFYYNQFDTDRSQLGNLYRNESMLTFETSQLQGAKDIVEKLVSLPFQKVQHRIT 67
Query: 68  TIDSQPCPSTGGLLIFVSGSLQLAGEDHHLRFSQMFHLIPTPRGSFAVQNDIFRLNYG 125
           T+D+QP    G +L+ ++G L +  E +  RFSQ+FHLIP    S+ V NDIFRLNY 
Sbjct: 68  TLDAQPASPYGDVLVMITGDLLIDEEQNPQRFSQVFHLIPDG-NSYYVFNDIFRLNYS 124
>pdb|1ZO2|A Chain A, Structure Of Nuclear Transport Factor 2 (Ntf2) From Cryptosporidium Parvum Length = 129 Back     alignment and structure
>pdb|1OUN|A Chain A, Crystal Structure Of Nuclear Transport Factor 2 (Ntf2) Length = 127 Back     alignment and structure
>pdb|1QMA|A Chain A, Nuclear Transport Factor 2 (Ntf2) W7a Mutant Length = 126 Back     alignment and structure
>pdb|1JB2|A Chain A, Crystal Structure Of Ntf2 M84e Mutant Length = 127 Back     alignment and structure
>pdb|1JB5|A Chain A, Crystal Structure Of Ntf2 M118e Mutant Length = 127 Back     alignment and structure
>pdb|1GY5|A Chain A, D92n,D94n Double Point Mutant Of Human Nuclear Transport Factor 2 (Ntf2) Length = 127 Back     alignment and structure
>pdb|1AR0|A Chain A, Nuclear Transport Factor 2 (Ntf2) E42k Mutant Length = 127 Back     alignment and structure
>pdb|1JB4|A Chain A, Crystal Structure Of Ntf2 M102e Mutant Length = 127 Back     alignment and structure
>pdb|1U5O|A Chain A, Structure Of The D23a Mutant Of The Nuclear Transport Carrier Ntf2 Length = 127 Back     alignment and structure
>pdb|1ASK|A Chain A, Nuclear Transport Factor 2 (Ntf2) H66a Mutant Length = 127 Back     alignment and structure
>pdb|3UJM|A Chain A, Crystal Structure Of The Ntf2-Like Domain Of The Drosophila Melanogaster Rasputin Protein Length = 120 Back     alignment and structure
>pdb|1JKG|A Chain A, Structural Basis For The Recognition Of A Nucleoporin Fg- Repeat By The Ntf2-Like Domain Of Tap-P15 Mrna Nuclear Export Factor Length = 140 Back     alignment and structure
>pdb|3NV0|B Chain B, Crystal Structure And Mutational Analysis Of The Nxf2NXT1 Heterodimeric Complex From Caenorhabditis Elegans At 1.84 A Resolution Length = 154 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query125
1gy7_A125 Nuclear transport factor 2; protein transport; 1.6 6e-44
1zo2_A129 NTF2, nuclear transport factor 2; structural genom 1e-41
1gy6_A127 Nuclear transport factor 2; 1.6A {Rattus norvegicu 1e-37
3ujm_A120 Rasputin; NTF2-like fold, RAS signaling, signaling 8e-36
1jkg_A140 P15; NTF2-like domain, transport protein; 1.90A {H 3e-34
3q90_A140 RAS GTPase-activating protein-binding protein 1; s 3e-33
3nv0_B154 NTF2-related export protein; NTF2-like domain, bet 4e-33
2qiy_A154 UBP3-associated protein BRE5; deubiquitylation, ub 1e-30
1jkg_B250 TAP; NTF2-like domain, transport protein; 1.90A {H 5e-16
1q40_B219 MEX67, mRNA export factor MEX67; NTF2-fold, nuclea 3e-06
1of5_A221 MRNA export factor MEX67; nuclear protein, repeat, 2e-05
>1gy7_A Nuclear transport factor 2; protein transport; 1.6A {Saccharomyces cerevisiae} SCOP: d.17.4.2 PDB: 1gyb_A Length = 125 Back     alignment and structure
 Score =  138 bits (350), Expect = 6e-44
 Identities = 54/125 (43%), Positives = 74/125 (59%), Gaps = 1/125 (0%)

Query: 1   MEDQTELVGKTFVGHYYHLFDNDRASLSSLYQPTSMLTFEGQKFFGVDDISTKFNQLPFD 60
           M      + + F   YY+ FD DR+ L +LY+  SMLTFE  +  G  DI  K   LPF 
Sbjct: 1   MSLDFNTLAQNFTQFYYNQFDTDRSQLGNLYRNESMLTFETSQLQGAKDIVEKLVSLPFQ 60

Query: 61  QCRHMISTIDSQPCPSTGGLLIFVSGSLQLAGEDHHLRFSQMFHLIPTPRGSFAVQNDIF 120
           + +H I+T+D+QP    G +L+ ++G L +  E +  RFSQ+FHLIP    S+ V NDIF
Sbjct: 61  KVQHRITTLDAQPASPYGDVLVMITGDLLIDEEQNPQRFSQVFHLIPDG-NSYYVFNDIF 119

Query: 121 RLNYG 125
           RLNY 
Sbjct: 120 RLNYS 124
>1zo2_A NTF2, nuclear transport factor 2; structural genomics, structural genomics consortium, SGC, transport protein; 1.60A {Cryptosporidium parvum} SCOP: d.17.4.2 Length = 129 Back     alignment and structure
>1gy6_A Nuclear transport factor 2; 1.6A {Rattus norvegicus} SCOP: d.17.4.2 PDB: 1a2k_A 1oun_A 1ar0_A 1u5o_A 1ask_A 1gy5_A 1jb5_A 1jb4_A 1jb2_A 1qma_A Length = 127 Back     alignment and structure
>3ujm_A Rasputin; NTF2-like fold, RAS signaling, signaling protein; HET: EPE; 2.74A {Drosophila melanogaster} Length = 120 Back     alignment and structure
>1jkg_A P15; NTF2-like domain, transport protein; 1.90A {Homo sapiens} SCOP: d.17.4.2 PDB: 1jn5_A Length = 140 Back     alignment and structure
>3q90_A RAS GTPase-activating protein-binding protein 1; structural genomics, structural genomics consortium, SGC, NT (A+B proteins); 1.70A {Homo sapiens} Length = 140 Back     alignment and structure
>3nv0_B NTF2-related export protein; NTF2-like domain, beta sheet heterodimer interface, nucleopo binding pocket, water mediated interface; 1.84A {Caenorhabditis elegans} Length = 154 Back     alignment and structure
>2qiy_A UBP3-associated protein BRE5; deubiquitylation, ubiquitin-specific processing proteases(UB NTF2, protein-protein recognition; 1.69A {Saccharomyces cerevisiae} SCOP: d.17.4.2 PDB: 1zx2_A Length = 154 Back     alignment and structure
>1jkg_B TAP; NTF2-like domain, transport protein; 1.90A {Homo sapiens} SCOP: d.17.4.2 PDB: 1jn5_B 1go5_A Length = 250 Back     alignment and structure
>1q40_B MEX67, mRNA export factor MEX67; NTF2-fold, nuclear export, translation; 1.95A {Candida albicans} SCOP: d.17.4.2 Length = 219 Back     alignment and structure
>1of5_A MRNA export factor MEX67; nuclear protein, repeat, leucine- rich repeat, nuclear transport; 2.8A {Saccharomyces cerevisiae} SCOP: d.17.4.2 Length = 221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query125
1gy7_A125 Nuclear transport factor 2; protein transport; 1.6 100.0
1zo2_A129 NTF2, nuclear transport factor 2; structural genom 100.0
1gy6_A127 Nuclear transport factor 2; 1.6A {Rattus norvegicu 100.0
3q90_A140 RAS GTPase-activating protein-binding protein 1; s 100.0
3ujm_A120 Rasputin; NTF2-like fold, RAS signaling, signaling 100.0
2qiy_A154 UBP3-associated protein BRE5; deubiquitylation, ub 100.0
3nv0_B154 NTF2-related export protein; NTF2-like domain, bet 100.0
1jkg_A140 P15; NTF2-like domain, transport protein; 1.90A {H 100.0
1jkg_B250 TAP; NTF2-like domain, transport protein; 1.90A {H 99.97
1q40_B219 MEX67, mRNA export factor MEX67; NTF2-fold, nuclea 99.97
1of5_A221 MRNA export factor MEX67; nuclear protein, repeat, 99.97
3nv0_A205 Nuclear RNA export factor 2; NTF2-like domain, bet 99.93
1q42_A201 MTR2, mRNA transport regulator MTR2; NTF2-fold, nu 99.92
1of5_B184 MTR2, YKL186C, mRNA transport regulator MTR2; nucl 99.82
4i4k_A143 Uncharacterized protein SGCJ; structural genomics, 98.4
3cu3_A172 Domain of unknown function with A cystatin-like F; 98.12
3hx8_A129 MLR2180 protein, putative ketosteroid isomerase; s 98.08
2gxf_A142 Hypothetical protein YYBH; alpha-beta protein., st 98.06
3d9r_A135 Ketosteroid isomerase-like protein; YP_049581.1, s 98.01
3gzr_A146 Uncharacterized protein with A NTF2-like fold; str 97.98
3rob_A139 Uncharacterized conserved protein; structural geno 97.87
3f7s_A142 Uncharacterized NTF2-like protein; structural geno 97.83
3h51_A156 Putative calcium/calmodulin dependent protein KIN 97.7
3b7c_A122 Uncharacterized protein; NTF-2 like protein, struc 97.64
3duk_A125 NTF2-like protein of unknown function; structural 97.57
3bb9_A148 Putative orphan protein; structural genomics, join 97.57
3gwr_A144 Putative calcium/calmodulin-dependent protein KIN 97.49
2rfr_A155 Uncharacterized protein; structural genomics, join 97.38
2chc_A170 Protein RV3472; hypothetical protein; 1.69A {Mycob 97.36
2ux0_A143 Calcium-calmodulin dependent protein kinase (CAM I 97.21
3b8l_A163 Uncharacterized protein; putative aromatic ring hy 97.18
2r4i_A123 Uncharacterized protein; NTF2-like protein, struct 97.13
3cnx_A170 Uncharacterized protein; putative dehydratase, NTF 97.08
2rcd_A129 Uncharacterized protein; structural genomics, join 97.05
3a76_A176 Gamma-hexachlorocyclohexane dehydrochlorinase; bar 97.03
1oh0_A131 Steroid delta-isomerase; ketosteroid isomerase, KS 96.89
3soy_A145 NTF2-like superfamily protein; structural genomics 96.78
3er7_A131 Uncharacterized NTF2-like protein; YP_001812677.1, 96.72
3fka_A120 Uncharacterized NTF-2 like protein; structural gen 96.6
3dm8_A143 Uncharacterized protein RPA4348; siras, putative i 96.5
3mg1_A323 OCP, orange carotenoid protein; carotenoid binding 96.32
3h3h_A122 Uncharacterized snoal-like protein; structural gen 96.28
3f7x_A151 Putative polyketide cyclase; structural genomics, 96.26
3blz_A128 NTF2-like protein of unknown function; structural 96.19
3i0y_A140 Putative polyketide cyclase; cystatin-like fold, s 96.15
3jum_A185 Phenazine biosynthesis protein A/B; chirality, dru 96.11
1ohp_A125 Steroid delta-isomerase; inhibitor; HET: ESR; 1.53 96.04
2bng_A149 MB2760; epoxide hydrolase, limonene, hydrolase, st 96.02
2rgq_A144 Domain of unknown function with A cystatin-like F; 96.01
4h3u_A158 Hypothetical protein; structural genomics, PSI-bio 96.0
3dmc_A134 NTF2-like protein; structural genomics, joint cent 95.97
3en8_A128 Uncharacterized NTF-2 like protein; YP_553245.1, N 95.93
3f14_A112 Uncharacterized NTF2-like protein; YP_680363.1, NT 95.82
3ef8_A150 Putative scyalone dehydratase; YP_496742.1, struct 95.68
2a15_A139 Hypothetical protein RV0760C; beta-alpha-barrel, s 95.3
1z1s_A163 Hypothetical protein PA3332; beta barrel, conserve 95.27
3ff0_A163 Phenazine biosynthesis protein PHZB 2; cystatin-li 95.23
1tp6_A128 Hypothetical protein PA1314; structural genomics, 95.23
2owp_A129 Hypothetical protein BXE_B1374; cystatin-like fold 95.08
3fh1_A129 Uncharacterized NTF2-like protein; structural geno 95.01
3fsd_A134 NTF2-like protein of unknown function in nutrient; 94.97
3mso_A143 Steroid delta-isomerase; structural genomics, join 94.79
1nww_A149 Limonene-1,2-epoxide hydrolase; HET: MES; 1.20A {R 94.59
3ff2_A117 Uncharacterized cystatin fold protein (YP_497570. 94.59
2f86_B143 Hypothetical protein K11E8.1D; UNC-43, oligomeriza 94.53
3ec9_A140 Uncharacterized NTF2-like protein; structural geno 94.47
3dxo_A121 Uncharacterized snoal-like protein; putative isome 94.36
2k54_A123 Protein ATU0742; protein of unknown function, stru 94.35
3g8z_A148 Protein of unknown function with cystatin-like FO; 94.11
3rga_A 283 Epoxide hydrolase; NTF2-like, epoxide-opening cycl 94.09
3ke7_A134 Putative ketosteroid isomerase; structural genomic 93.87
3rga_A283 Epoxide hydrolase; NTF2-like, epoxide-opening cycl 93.8
1s5a_A150 Hypothetical protein YESE; structural genomics, PS 93.57
3ebt_A132 Uncharacterized NTF2-like protein; structural geno 93.44
3fgy_A135 Uncharacterized NTF2-like protein; structural geno 93.39
3hk4_A136 MLR7391 protein; NTF2-like protein, structural gen 93.12
3gzb_A154 Putative snoal-like polyketide cyclase; YP_0011826 93.07
1tuh_A156 BAL32A, hypothetical protein EGC068; unknown funct 92.81
3grd_A134 Uncharacterized NTF2-superfamily protein; NP_97724 92.02
2gex_A152 SNOL; alpha+beta barrel, oxidoreductase; 2.50A {St 91.89
3ejv_A179 Uncharacterized protein with cystatin-like fold; s 91.48
3f40_A114 Uncharacterized NTF2-like protein; YP_677363.1, NT 91.39
3k0z_A159 Putative polyketide cyclase; structural genomics, 91.36
3kkg_A146 Putative snoal-like polyketide cyclase; structural 90.88
2gey_A158 ACLR protein; alpha+beta barrel, oxidoreductase; H 90.79
3f9s_A146 Putative polyketide cyclase; structural genomics, 90.77
3f8x_A148 Putative delta-5-3-ketosteroid isomerase; structur 90.6
3f8h_A150 Putative polyketide cyclase; structural genomics, 90.3
3ehc_A128 Snoal-like polyketide cyclase; structural genomics 90.17
3g16_A156 Uncharacterized protein with cystatin-like fold; Y 87.26
1sjw_A144 Nogalonic acid methyl ester cyclase; anthracycline 84.26
3g0k_A148 Putative membrane protein; snoal-like polyketide c 83.61
2f99_A153 Aklanonic acid methyl ester cyclase, AKNH; anthrac 83.22
3lyg_A120 NTF2-like protein of unknown function; structural 82.42
>1gy7_A Nuclear transport factor 2; protein transport; 1.6A {Saccharomyces cerevisiae} SCOP: d.17.4.2 PDB: 1gyb_A Back     alignment and structure
Probab=100.00  E-value=1.5e-46  Score=253.61  Aligned_cols=124  Identities=44%  Similarity=0.772  Sum_probs=115.9

Q ss_pred             CCCCHHHHHHHHHHHHhhccccChhhhcccccCCceEEEcCceecCHHHHHHHHhcCCCCcceEEeEEeeeeecCCCCcE
Q 033171            1 MEDQTELVGKTFVGHYYHLFDNDRASLSSLYQPTSMLTFEGQKFFGVDDISTKFNQLPFDQCRHMISTIDSQPCPSTGGL   80 (125)
Q Consensus         1 ~~~~~~~i~~~Fv~~YY~~l~~~r~~L~~~Y~~~S~~t~~g~~~~G~~~I~~~l~~lp~~~~~~~i~s~D~q~~~~~~~i   80 (125)
                      |.|++++||+.||++||++||++|+.|++||+++|+++|+|+.+.|+++|.++|.+||+++++|+|+++||||++++++|
T Consensus         1 m~m~~~~v~~~Fv~~YY~~~d~~r~~L~~~Y~~~S~~s~~g~~~~G~~~I~~~l~~Lp~~~~~h~i~t~D~qp~~~~~gi   80 (125)
T 1gy7_A            1 MSLDFNTLAQNFTQFYYNQFDTDRSQLGNLYRNESMLTFETSQLQGAKDIVEKLVSLPFQKVQHRITTLDAQPASPYGDV   80 (125)
T ss_dssp             ---CHHHHHHHHHHHHHHHHHHHGGGGGGGEEEEEEEEETTEEEESHHHHHHHHHHSCCSCEEEEEEEEEEEESSTTSCE
T ss_pred             CCCCHHHHHHHHHHHHHHHHcCCHHHHHHhhCCCcEEEECCcEecCHHHHHHHHHhCCCcceEEEEEEEEEEEecCCCeE
Confidence            78899999999999999999999999999999999999999999999999999999999999999999999999556899


Q ss_pred             EEEEEEEEEEcCCCCceeeEEEEEEeeCCCCcEEEEceeEEeecC
Q 033171           81 LIFVSGSLQLAGEDHHLRFSQMFHLIPTPRGSFAVQNDIFRLNYG  125 (125)
Q Consensus        81 lI~V~G~~~~~~~~~~~~F~qtF~L~~~~~~~y~I~nD~fr~~~~  125 (125)
                      +|+|+|.++.+++.++++|+|||+|+|.+ ++|+|.||+|||++|
T Consensus        81 li~V~G~~~~~~~~~~~~F~qtF~L~p~~-~~~~I~nD~fr~~~~  124 (125)
T 1gy7_A           81 LVMITGDLLIDEEQNPQRFSQVFHLIPDG-NSYYVFNDIFRLNYS  124 (125)
T ss_dssp             EEEEEEEEEETTCSSCEEEEEEEEEEEET-TEEEEEEEEEEEECC
T ss_pred             EEEEEEEEEECCCCCCccEeEEEEEEEeC-CEEEEEEEEEEEecC
Confidence            99999999998874599999999999998 799999999999985
>1zo2_A NTF2, nuclear transport factor 2; structural genomics, structural genomics consortium, SGC, transport protein; 1.60A {Cryptosporidium parvum} SCOP: d.17.4.2 Back     alignment and structure
>1gy6_A Nuclear transport factor 2; 1.6A {Rattus norvegicus} SCOP: d.17.4.2 PDB: 1a2k_A 1oun_A 1ar0_A 1u5o_A 1ask_A 1gy5_A 1jb5_A 1jb4_A 1jb2_A 1qma_A Back     alignment and structure
>3q90_A RAS GTPase-activating protein-binding protein 1; structural genomics, structural genomics consortium, SGC, NT (A+B proteins); 1.70A {Homo sapiens} SCOP: d.17.4.0 Back     alignment and structure
>3ujm_A Rasputin; NTF2-like fold, RAS signaling, signaling protein; HET: EPE; 2.74A {Drosophila melanogaster} Back     alignment and structure
>2qiy_A UBP3-associated protein BRE5; deubiquitylation, ubiquitin-specific processing proteases(UB NTF2, protein-protein recognition; 1.69A {Saccharomyces cerevisiae} SCOP: d.17.4.2 PDB: 1zx2_A Back     alignment and structure
>3nv0_B NTF2-related export protein; NTF2-like domain, beta sheet heterodimer interface, nucleopo binding pocket, water mediated interface; 1.84A {Caenorhabditis elegans} Back     alignment and structure
>1jkg_A P15; NTF2-like domain, transport protein; 1.90A {Homo sapiens} SCOP: d.17.4.2 PDB: 1jn5_A Back     alignment and structure
>1jkg_B TAP; NTF2-like domain, transport protein; 1.90A {Homo sapiens} SCOP: d.17.4.2 PDB: 1jn5_B 1go5_A Back     alignment and structure
>1q40_B MEX67, mRNA export factor MEX67; NTF2-fold, nuclear export, translation; 1.95A {Candida albicans} SCOP: d.17.4.2 Back     alignment and structure
>1of5_A MRNA export factor MEX67; nuclear protein, repeat, leucine- rich repeat, nuclear transport; 2.8A {Saccharomyces cerevisiae} SCOP: d.17.4.2 Back     alignment and structure
>3nv0_A Nuclear RNA export factor 2; NTF2-like domain, beta sheet heterodimer interface, nucleopo binding pocket, water mediated interface; 1.84A {Caenorhabditis elegans} Back     alignment and structure
>1q42_A MTR2, mRNA transport regulator MTR2; NTF2-fold, nuclear export, translation; 1.75A {Candida albicans} SCOP: d.17.4.2 PDB: 1q40_A Back     alignment and structure
>1of5_B MTR2, YKL186C, mRNA transport regulator MTR2; nuclear protein, repeat, leucine- rich repeat, nuclear transport; 2.8A {Saccharomyces cerevisiae} SCOP: d.17.4.2 Back     alignment and structure
>4i4k_A Uncharacterized protein SGCJ; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: CIT PG4 1PE; 1.70A {Streptomyces globisporus} Back     alignment and structure
>3cu3_A Domain of unknown function with A cystatin-like F; structural genomics, joint center for structural genomics, J protein structure initiative; 2.00A {Nostoc punctiforme} SCOP: d.17.4.28 Back     alignment and structure
>3hx8_A MLR2180 protein, putative ketosteroid isomerase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; HET: MSE UNL PG4; 1.45A {Mesorhizobium loti} Back     alignment and structure
>2gxf_A Hypothetical protein YYBH; alpha-beta protein., structural genomics, PSI, protein structure initiative; HET: MES; 3.10A {Bacillus subtilis} SCOP: d.17.4.22 Back     alignment and structure
>3d9r_A Ketosteroid isomerase-like protein; YP_049581.1, structural joint center for structural genomics, JCSG, protein structu initiative; HET: MSE; 2.40A {Pectobacterium atrosepticum} SCOP: d.17.4.27 Back     alignment and structure
>3gzr_A Uncharacterized protein with A NTF2-like fold; structural genomics, joint center for struct genomics, JCSG, protein structure initiative; HET: MSE GOL; 1.40A {Caulobacter vibrioides} Back     alignment and structure
>3rob_A Uncharacterized conserved protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics; 1.48A {Planctomyces limnophilus} Back     alignment and structure
>3f7s_A Uncharacterized NTF2-like protein; structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2; 2.11A {Pseudomonas putida KT2440} Back     alignment and structure
>3h51_A Putative calcium/calmodulin dependent protein KIN association domain; NP_636218.1; HET: MSE PG4; 1.70A {Xanthomonas campestris PV} Back     alignment and structure
>3b7c_A Uncharacterized protein; NTF-2 like protein, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.70A {Shewanella oneidensis} SCOP: d.17.4.16 Back     alignment and structure
>3duk_A NTF2-like protein of unknown function; structural genomics, joint center for STR genomics, JCSG, protein structure initiative; HET: MSE; 2.20A {Methylobacillus flagellatus KT} SCOP: d.17.4.0 Back     alignment and structure
>3bb9_A Putative orphan protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 1.80A {Shewanella frigidimarina} SCOP: d.17.4.16 Back     alignment and structure
>3gwr_A Putative calcium/calmodulin-dependent protein KIN II association domain; YP_315894.1; HET: MSE PG4; 2.01A {Thiobacillus denitrificans atcc 25259} Back     alignment and structure
>2rfr_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.16A {Novosphingobium aromaticivorans} SCOP: d.17.4.28 Back     alignment and structure
>2chc_A Protein RV3472; hypothetical protein; 1.69A {Mycobacterium tuberculosis} SCOP: d.17.4.25 Back     alignment and structure
>2ux0_A Calcium-calmodulin dependent protein kinase (CAM II gamma; transferase, oligomerisation DOM serine- threonine kinase, ATP-binding; 2.46A {Homo sapiens} SCOP: d.17.4.7 PDB: 2w2c_A 1hkx_A* Back     alignment and structure
>3b8l_A Uncharacterized protein; putative aromatic ring hydroxylase, structural genomics, JOI for structural genomics, JCSG; HET: MSE; 1.75A {Novosphingobium aromaticivorans} SCOP: d.17.4.28 Back     alignment and structure
>2r4i_A Uncharacterized protein; NTF2-like protein, structural genomics, joint center for STR genomics, JCSG; HET: MSE CIT; 1.60A {Cytophaga hutchinsonii atcc 33406} SCOP: d.17.4.15 Back     alignment and structure
>3cnx_A Uncharacterized protein; putative dehydratase, NTF2-like protein, structural genomics center for structural genomics, JCSG; HET: MSE PGE PG6; 2.10A {Streptomyces avermitilis} SCOP: d.17.4.17 Back     alignment and structure
>2rcd_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 2.32A {Pectobacterium atrosepticum SCRI1043} SCOP: d.17.4.18 Back     alignment and structure
>3a76_A Gamma-hexachlorocyclohexane dehydrochlorinase; barrel fold, lyase, detoxification; HET: SPD; 2.25A {Sphingomonas paucimobilis} Back     alignment and structure
>1oh0_A Steroid delta-isomerase; ketosteroid isomerase, KSI, equilenin, PI, LBHB; HET: EQU; 1.1A {Pseudomonas putida} SCOP: d.17.4.3 PDB: 1e3v_A* 1opy_A 1dmq_A 1dmm_A 1ea2_A 3cpo_A 1e3r_A* 1ogx_A 2inx_A 2pzv_A 1c7h_A 1dmn_A 1k41_A 1oho_A* 3fzw_A* 1cqs_A* 1w00_A 1e97_A 1w6y_A* 3ipt_A* ... Back     alignment and structure
>3soy_A NTF2-like superfamily protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.00A {Salmonella enterica subsp} Back     alignment and structure
>3er7_A Uncharacterized NTF2-like protein; YP_001812677.1, NTF2-like protein of unknown function, struc genomics; HET: MSE; 1.50A {Exiguobacterium sibiricum 255-15} SCOP: d.17.4.24 Back     alignment and structure
>3fka_A Uncharacterized NTF-2 like protein; structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.69A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>3dm8_A Uncharacterized protein RPA4348; siras, putative isomerase, structural genomics, PSI-2, prote structure initiative; HET: CE9; 1.80A {Rhodopseudomonas palustris} SCOP: d.17.4.20 Back     alignment and structure
>3mg1_A OCP, orange carotenoid protein; carotenoid binding protein, echinone, phycobilisome; HET: ECH; 1.65A {Synechocystis SP} PDB: 3mg2_A* 3mg3_A* 1m98_A* Back     alignment and structure
>3h3h_A Uncharacterized snoal-like protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE UNL MES; 1.60A {Burkholderia thailandensis E264} Back     alignment and structure
>3f7x_A Putative polyketide cyclase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL; 1.24A {Pseudomonas putida KT2440} Back     alignment and structure
>3blz_A NTF2-like protein of unknown function; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.75A {Shewanella baltica} SCOP: d.17.4.14 Back     alignment and structure
>3i0y_A Putative polyketide cyclase; cystatin-like fold, structural genomics, joint center for ST genomics, JCSG, protein structure initiative; HET: MSE UNL; 1.50A {Xanthomonas campestris PV} Back     alignment and structure
>3jum_A Phenazine biosynthesis protein A/B; chirality, drug design, medicinal CH inhibitor, biosynthetic protein; HET: AOD; 1.45A {Burkholderia SP} PDB: 3b4o_A* 3b4p_A* 3dzl_A* 3ex9_A 3cnm_A* 3jun_A* 3juo_A* 3jup_A* 3juq_A* Back     alignment and structure
>1ohp_A Steroid delta-isomerase; inhibitor; HET: ESR; 1.53A {Pseudomonas testosteroni} SCOP: d.17.4.3 PDB: 1qjg_A* 8cho_A* 1ohs_A* 1ocv_A 1isk_A 3nuv_A* 1ogz_A* 3nhx_A* 3m8c_A* 3nxj_A* 3myt_A* 3mki_A 3mhe_A 1buq_A* 3nbr_A* 3t8u_A 3ov4_A* 3nm2_A Back     alignment and structure
>2bng_A MB2760; epoxide hydrolase, limonene, hydrolase, structural proteomics in europe, spine, structural genomics; 2.5A {Mycobacterium tuberculosis} SCOP: d.17.4.8 Back     alignment and structure
>2rgq_A Domain of unknown function with A cystatin-like F; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 1.80A {Nostoc punctiforme} SCOP: d.17.4.25 Back     alignment and structure
>4h3u_A Hypothetical protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 1.15A {Catenulispora acidiphila} Back     alignment and structure
>3dmc_A NTF2-like protein; structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2, unknow function; 1.65A {Anabaena variabilis atcc 29413} SCOP: d.17.4.10 Back     alignment and structure
>3en8_A Uncharacterized NTF-2 like protein; YP_553245.1, NTF-2 like protein of unknown function, structu genomics; HET: MSE PG4; 1.85A {Burkholderia xenovorans LB400} SCOP: d.17.4.20 Back     alignment and structure
>3f14_A Uncharacterized NTF2-like protein; YP_680363.1, NTF2-like protein of unknown function, structur genomics; HET: MSE TRS PGE; 1.45A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>3ef8_A Putative scyalone dehydratase; YP_496742.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE PG4; 1.50A {Novosphingobium aromaticivorans DSM12444} SCOP: d.17.4.28 Back     alignment and structure
>2a15_A Hypothetical protein RV0760C; beta-alpha-barrel, structural genomics, PSI, protein structure initiative; 1.68A {Mycobacterium tuberculosis} SCOP: d.17.4.3 PDB: 2z76_A* 2z77_A* 2z7a_A Back     alignment and structure
>1z1s_A Hypothetical protein PA3332; beta barrel, conserved hypothetical protein, structural genomics, PSI, protein structure initiative; HET: PGE; 1.49A {Pseudomonas aeruginosa PAO1} SCOP: d.17.4.10 Back     alignment and structure
>3ff0_A Phenazine biosynthesis protein PHZB 2; cystatin-like fold, antibiotic biosynthesis, virulence, STRU genomics; 1.90A {Pseudomonas aeruginosa} Back     alignment and structure
>1tp6_A Hypothetical protein PA1314; structural genomics, alpha-beta sandwich, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa PAO1} SCOP: d.17.4.12 Back     alignment and structure
>2owp_A Hypothetical protein BXE_B1374; cystatin-like fold, DUF3225 family protein, structural genom joint center for structural genomics, JCSG; 2.00A {Burkholderia xenovorans} SCOP: d.17.4.18 Back     alignment and structure
>3fh1_A Uncharacterized NTF2-like protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 1.60A {Mesorhizobium loti} Back     alignment and structure
>3fsd_A NTF2-like protein of unknown function in nutrient; YP_427473.1, NTF2-like protein of unknown function in nutrie uptake; HET: UNL; 1.70A {Rhodospirillum rubrum atcc 11170} SCOP: d.17.4.0 Back     alignment and structure
>3mso_A Steroid delta-isomerase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 2.57A {Pseudomonas aeruginosa} Back     alignment and structure
>1nww_A Limonene-1,2-epoxide hydrolase; HET: MES; 1.20A {Rhodococcus erythropolis} SCOP: d.17.4.8 PDB: 1nu3_A* Back     alignment and structure
>3ff2_A Uncharacterized cystatin fold protein (YP_497570. NTF2 superfamily; structural genomics; 1.90A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} Back     alignment and structure
>2f86_B Hypothetical protein K11E8.1D; UNC-43, oligomerization domain, transferase; 2.64A {Caenorhabditis elegans} SCOP: d.17.4.7 Back     alignment and structure
>3ec9_A Uncharacterized NTF2-like protein; structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.60A {Burkholderia thailandensis E264} SCOP: d.17.4.10 Back     alignment and structure
>3dxo_A Uncharacterized snoal-like protein; putative isomerase of the snoal-like family; HET: MSE PGE; 2.70A {Agrobacterium tumefaciens str} SCOP: d.17.4.19 Back     alignment and structure
>2k54_A Protein ATU0742; protein of unknown function, structural genomics, PSI-2, Pro structure initiative; NMR {Agrobacterium tumefaciens str} SCOP: d.17.4.29 Back     alignment and structure
>3g8z_A Protein of unknown function with cystatin-like FO; NP_639274.1, snoal-like polyketide cyclase; HET: MSE; 1.90A {Xanthomonas campestris PV} Back     alignment and structure
>3rga_A Epoxide hydrolase; NTF2-like, epoxide-opening cyclic ether formation, isomerase; HET: LSB ILD; 1.59A {Streptomyces lasaliensis} Back     alignment and structure
>3ke7_A Putative ketosteroid isomerase; structural genomics, joint C structural genomics, JCSG, protein structure initiative; HET: MSE BCN; 1.45A {Parabacteroides distasonis atcc 8503} Back     alignment and structure
>3rga_A Epoxide hydrolase; NTF2-like, epoxide-opening cyclic ether formation, isomerase; HET: LSB ILD; 1.59A {Streptomyces lasaliensis} Back     alignment and structure
>1s5a_A Hypothetical protein YESE; structural genomics, PSI, protein STRU initiative, midwest center for structural genomics, MCSG, U function; 1.70A {Bacillus subtilis} SCOP: d.17.4.10 Back     alignment and structure
>3ebt_A Uncharacterized NTF2-like protein; structural genomics, joint center for structural genomics, J protein structure initiative; 1.30A {Burkholderia pseudomallei K96243} SCOP: d.17.4.9 Back     alignment and structure
>3fgy_A Uncharacterized NTF2-like protein; structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.59A {Burkholderia xenovorans LB400} SCOP: d.17.4.0 Back     alignment and structure
>3hk4_A MLR7391 protein; NTF2-like protein, structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2, lyase; HET: MSE; 1.96A {Mesorhizobium loti} Back     alignment and structure
>3gzb_A Putative snoal-like polyketide cyclase; YP_001182657.1, STRU genomics, joint center for structural genomics, JCSG; HET: MSE; 1.44A {Shewanella putrefaciens} PDB: 3lza_A* Back     alignment and structure
>1tuh_A BAL32A, hypothetical protein EGC068; unknown function; 1.85A {Uncultured bacterium} SCOP: d.17.4.11 Back     alignment and structure
>3grd_A Uncharacterized NTF2-superfamily protein; NP_977240.1, NTF2-superfamily protein with unknown function, structural genomics; HET: MSE; 1.25A {Bacillus cereus atcc 10987} SCOP: d.17.4.0 Back     alignment and structure
>2gex_A SNOL; alpha+beta barrel, oxidoreductase; 2.50A {Streptomyces nogalater} SCOP: d.17.4.9 Back     alignment and structure
>3ejv_A Uncharacterized protein with cystatin-like fold; structural genomics, joint center for ST genomics, JCSG; HET: MSE PGE; 1.40A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} SCOP: d.17.4.28 Back     alignment and structure
>3f40_A Uncharacterized NTF2-like protein; YP_677363.1, NTF2-like protein of unknown function, structural genomics; HET: MSE; 1.27A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>3k0z_A Putative polyketide cyclase; structural genomics, joint CENT structural genomics, JCSG, protein structure initiative, PS lipoprotein; HET: NHE; 1.91A {Bacillus cereus} Back     alignment and structure
>3kkg_A Putative snoal-like polyketide cyclase; structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2, lyase; HET: MSE PGE; 1.40A {Jannaschia SP} Back     alignment and structure
>2gey_A ACLR protein; alpha+beta barrel, oxidoreductase; HET: PG4; 1.80A {Streptomyces galilaeus} SCOP: d.17.4.9 Back     alignment and structure
>3f9s_A Putative polyketide cyclase; structural genomics, joint center for structural genomics, J protein structure initiative; 1.76A {Acidithiobacillus ferrooxidans atcc 23} Back     alignment and structure
>3f8x_A Putative delta-5-3-ketosteroid isomerase; structural genomics, joint center for structural genomics; HET: MSE; 1.55A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>3f8h_A Putative polyketide cyclase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, unknown function; HET: MSE; 2.00A {Silicibacter SP} Back     alignment and structure
>3ehc_A Snoal-like polyketide cyclase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.12A {Agrobacterium tumefaciens str} Back     alignment and structure
>3g16_A Uncharacterized protein with cystatin-like fold; YP_001022489.1, protein of unknown function with cystatin-LI structural genomics; HET: MSE; 1.45A {Methylibium petroleiphilum PM1} Back     alignment and structure
>1sjw_A Nogalonic acid methyl ester cyclase; anthracyclines, nogalamycin, snoal, aldol condensation, LYAS structural genomics; HET: NGV; 1.35A {Streptomyces nogalater} SCOP: d.17.4.9 Back     alignment and structure
>3g0k_A Putative membrane protein; snoal-like polyketide cyclase, structural genomics, joint CE structural genomics, JCSG; HET: MSE; 1.30A {Novosphingobium aromaticivorans} Back     alignment and structure
>2f99_A Aklanonic acid methyl ester cyclase, AKNH; anthracycline,polyketide cyclase,stereoselectivity, aklavino biosynthetic protein; HET: AKV; 1.90A {Streptomyces galilaeus} SCOP: d.17.4.9 PDB: 2f98_A* Back     alignment and structure
>3lyg_A NTF2-like protein of unknown function; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE GOL; 1.61A {Colwellia psychrerythraea} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 125
d1gy7a_121 d.17.4.2 (A:) Nuclear transport factor-2 (NTF2) {B 4e-43
d1zo2a1117 d.17.4.2 (A:10-126) Nuclear transport factor-2 (NT 3e-41
d1gy6a_125 d.17.4.2 (A:) Nuclear transport factor-2 (NTF2) {R 4e-38
d1jkga_139 d.17.4.2 (A:) NTF2-related export protein 1 (p15) 1e-32
d2qiya1139 d.17.4.2 (A:3-141) UBP3-associated protein BRE5 {B 2e-29
d1of5b_165 d.17.4.2 (B:) mRNA transport regulator MTR2 {Baker 2e-13
d1q40b_205 d.17.4.2 (B:) NTF2-like domain of mRNA export fact 4e-06
d1jkgb_186 d.17.4.2 (B:) NTF2-like domain of Tip associating 2e-05
d1of5a_221 d.17.4.2 (A:) NTF2-like domain of mRNA export fact 4e-04
>d1gy7a_ d.17.4.2 (A:) Nuclear transport factor-2 (NTF2) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 121 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Cystatin-like
superfamily: NTF2-like
family: NTF2-like
domain: Nuclear transport factor-2 (NTF2)
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

 Score =  135 bits (341), Expect = 4e-43
 Identities = 53/117 (45%), Positives = 73/117 (62%), Gaps = 1/117 (0%)

Query: 8   VGKTFVGHYYHLFDNDRASLSSLYQPTSMLTFEGQKFFGVDDISTKFNQLPFDQCRHMIS 67
           + + F   YY+ FD DR+ L +LY+  SMLTFE  +  G  DI  K   LPF + +H I+
Sbjct: 5   LAQNFTQFYYNQFDTDRSQLGNLYRNESMLTFETSQLQGAKDIVEKLVSLPFQKVQHRIT 64

Query: 68  TIDSQPCPSTGGLLIFVSGSLQLAGEDHHLRFSQMFHLIPTPRGSFAVQNDIFRLNY 124
           T+D+QP    G +L+ ++G L +  E +  RFSQ+FHLIP    S+ V NDIFRLNY
Sbjct: 65  TLDAQPASPYGDVLVMITGDLLIDEEQNPQRFSQVFHLIPDG-NSYYVFNDIFRLNY 120
>d1zo2a1 d.17.4.2 (A:10-126) Nuclear transport factor-2 (NTF2) {Cryptosporidium parvum [TaxId: 5807]} Length = 117 Back     information, alignment and structure
>d1gy6a_ d.17.4.2 (A:) Nuclear transport factor-2 (NTF2) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 125 Back     information, alignment and structure
>d1jkga_ d.17.4.2 (A:) NTF2-related export protein 1 (p15) {Human (Homo sapiens) [TaxId: 9606]} Length = 139 Back     information, alignment and structure
>d2qiya1 d.17.4.2 (A:3-141) UBP3-associated protein BRE5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 139 Back     information, alignment and structure
>d1of5b_ d.17.4.2 (B:) mRNA transport regulator MTR2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 165 Back     information, alignment and structure
>d1q40b_ d.17.4.2 (B:) NTF2-like domain of mRNA export factor MEX67 {Yeast (Candida albicans) [TaxId: 5476]} Length = 205 Back     information, alignment and structure
>d1jkgb_ d.17.4.2 (B:) NTF2-like domain of Tip associating protein, TAP {Human (Homo sapiens) [TaxId: 9606]} Length = 186 Back     information, alignment and structure
>d1of5a_ d.17.4.2 (A:) NTF2-like domain of mRNA export factor MEX67 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 221 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query125
d1gy7a_121 Nuclear transport factor-2 (NTF2) {Baker's yeast ( 100.0
d1gy6a_125 Nuclear transport factor-2 (NTF2) {Rat (Rattus nor 100.0
d1zo2a1117 Nuclear transport factor-2 (NTF2) {Cryptosporidium 100.0
d1jkga_139 NTF2-related export protein 1 (p15) {Human (Homo s 100.0
d2qiya1139 UBP3-associated protein BRE5 {Baker's yeast (Sacch 100.0
d1q40b_205 NTF2-like domain of mRNA export factor MEX67 {Yeas 99.9
d1jkgb_186 NTF2-like domain of Tip associating protein, TAP { 99.89
d1of5a_221 NTF2-like domain of mRNA export factor MEX67 {Bake 99.89
d1of5b_165 mRNA transport regulator MTR2 {Baker's yeast (Sacc 99.88
d1q42a_174 mRNA transport regulator MTR2 {Yeast (Candida albi 99.5
d2gxfa1128 Hypothetical protein YybH {Bacillus subtilis [TaxI 98.01
d3d9ra1132 Uncharacterized protein ECA1476 {Pectobacterium at 97.98
d3b7ca1121 Uncharacterized protein SO0125 {Shewanella oneiden 97.94
d3bb9a1121 Uncharacterized protein Sfri1973 {Shewanella frigi 97.89
d3en8a1127 Uncharacterized protein BxeB2092 {Burkholderia xen 97.71
d3cu3a1162 Uncharacterized protein NpunR1993 {Nostoc punctifo 97.7
d2owpa1128 Hypothetical protein BxeB1374 {Burkholderia xenovo 97.7
d1m98a2142 Orange carotenoid protein, C-terminal domain {Cyan 97.7
d2rcda1127 Uncharacterized protein ECA3500 {Pectobacterium at 97.42
d2r4ia1122 Uncharacterized protein CHU142 {Cytophaga hutchins 97.38
d1s5aa_139 Hypothetical protein YesE {Bacillus subtilis [TaxI 97.23
d3dmca1133 Uncharacterized protein Ava2261 {Anabaena variabil 97.22
d2f86b1129 Association domain of calcium/calmodulin-dependent 97.2
d3cnxa1153 Uncharacterized protein SAV4671 {Streptomyces aver 97.12
d1ohpa1125 Delta-5-3-ketosteroid isomerase, steroid delta-iso 97.11
d2bnga1132 Uncharacterized protein Mb2760 {Mycobacterium tube 97.01
d1oh0a_125 Delta-5-3-ketosteroid isomerase, steroid delta-iso 96.96
d1z1sa1129 Uncharacterized protein PA3332 {Pseudomonas aerugi 96.92
d2ux0a1135 Association domain of calcium/calmodulin-dependent 96.92
d2rgqa1133 Uncharacterized protein NpunR3134 {Nostoc punctifo 96.58
d3dm8a1135 Uncharacterized protein Rpa4348 {Rhodopseudomonas 96.42
d2chca1167 Uncharacterized protein Rv3472 {Mycobacterium tube 96.41
d2a15a1132 Hypothetical protein Rv0760c {Mycobacterium tuberc 96.3
d3blza1124 Uncharacterized protein Sbal0622 {Shewanella balti 96.3
d3ebta1131 Uncharacterized protein BPSS0132 {Burkholderia pse 95.92
d2rfra1153 Uncharacterized protein Saro3722 {Novosphingobium 95.5
d3b8la1144 Uncharacterized protein Saro3538 {Novosphingobium 95.45
d3dxoa1117 Uncharacterized protein Atu0744 {Agrobacterium tum 95.36
d1nwwa_145 Limonene-1,2-epoxide hydrolase {Rhodococcus erythr 94.97
d1tuha_131 Hypothetical protein egc068 from a soil-derived mo 94.9
d3ec9a1130 Uncharacterized protein BTHI0051 {Burkholderia tha 94.62
d2k54a1123 Uncharacterized protein Atu0742 {Agrobacterium tum 93.92
d3er7a1118 Uncharacterized protein Exig0174 {Exiguobacterium 93.92
d2gexa1138 Nogalamycin biosynthesis protein SnoL {Streptomyce 92.86
d2geya1144 Putative hydroxylase AclR {Streptomyces galilaeus 92.5
d3ef8a1149 Uncharacterized protein Saro1465 {Novosphingobium 86.01
>d1gy7a_ d.17.4.2 (A:) Nuclear transport factor-2 (NTF2) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Cystatin-like
superfamily: NTF2-like
family: NTF2-like
domain: Nuclear transport factor-2 (NTF2)
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=100.00  E-value=9.2e-45  Score=241.97  Aligned_cols=120  Identities=44%  Similarity=0.795  Sum_probs=114.7

Q ss_pred             CHHHHHHHHHHHHhhccccChhhhcccccCCceEEEcCceecCHHHHHHHHhcCCCCcceEEeEEeeeeecCCCCcEEEE
Q 033171            4 QTELVGKTFVGHYYHLFDNDRASLSSLYQPTSMLTFEGQKFFGVDDISTKFNQLPFDQCRHMISTIDSQPCPSTGGLLIF   83 (125)
Q Consensus         4 ~~~~i~~~Fv~~YY~~l~~~r~~L~~~Y~~~S~~t~~g~~~~G~~~I~~~l~~lp~~~~~~~i~s~D~q~~~~~~~ilI~   83 (125)
                      |+++||++||++||++|+++|+.|++||+++|.|+|+|+++.|+++|.++|++||+++++|+|.++||||++.+++++|+
T Consensus         1 d~~~Ia~~Fv~~YY~~l~~~r~~L~~~Y~~~s~l~~~g~~~~G~~~I~~~l~~lp~~~~~~~i~~~D~Qp~~~~~~ili~   80 (121)
T d1gy7a_           1 DFNTLAQNFTQFYYNQFDTDRSQLGNLYRNESMLTFETSQLQGAKDIVEKLVSLPFQKVQHRITTLDAQPASPYGDVLVM   80 (121)
T ss_dssp             CHHHHHHHHHHHHHHHHHHHGGGGGGGEEEEEEEEETTEEEESHHHHHHHHHHSCCSCEEEEEEEEEEEESSTTSCEEEE
T ss_pred             CHHHHHHHHHHHHHHHHhcCHHHHHHHcCCCcEEEECCeEecCHHHHHHHHHhCCCcccEEEEeeEeeEEccCCCeEEEE
Confidence            67999999999999999999999999999999999999999999999999999999999999999999998567899999


Q ss_pred             EEEEEEEcCCCCceeeEEEEEEeeCCCCcEEEEceeEEeec
Q 033171           84 VSGSLQLAGEDHHLRFSQMFHLIPTPRGSFAVQNDIFRLNY  124 (125)
Q Consensus        84 V~G~~~~~~~~~~~~F~qtF~L~~~~~~~y~I~nD~fr~~~  124 (125)
                      |+|.++.++++++++|+|+|+|++++ ++|+|.|||||+++
T Consensus        81 V~G~~~~~~~~~~~~F~qtF~L~~~~-~~y~I~nD~FRl~~  120 (121)
T d1gy7a_          81 ITGDLLIDEEQNPQRFSQVFHLIPDG-NSYYVFNDIFRLNY  120 (121)
T ss_dssp             EEEEEEETTCSSCEEEEEEEEEEEET-TEEEEEEEEEEEEC
T ss_pred             EEEEEEECCCCCcceeEEEEEEEeeC-CEEEEEEEEEEEec
Confidence            99999998876689999999999998 99999999999986
>d1gy6a_ d.17.4.2 (A:) Nuclear transport factor-2 (NTF2) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zo2a1 d.17.4.2 (A:10-126) Nuclear transport factor-2 (NTF2) {Cryptosporidium parvum [TaxId: 5807]} Back     information, alignment and structure
>d1jkga_ d.17.4.2 (A:) NTF2-related export protein 1 (p15) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qiya1 d.17.4.2 (A:3-141) UBP3-associated protein BRE5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q40b_ d.17.4.2 (B:) NTF2-like domain of mRNA export factor MEX67 {Yeast (Candida albicans) [TaxId: 5476]} Back     information, alignment and structure
>d1jkgb_ d.17.4.2 (B:) NTF2-like domain of Tip associating protein, TAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1of5a_ d.17.4.2 (A:) NTF2-like domain of mRNA export factor MEX67 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1of5b_ d.17.4.2 (B:) mRNA transport regulator MTR2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q42a_ d.17.4.2 (A:) mRNA transport regulator MTR2 {Yeast (Candida albicans) [TaxId: 5476]} Back     information, alignment and structure
>d2gxfa1 d.17.4.22 (A:1-128) Hypothetical protein YybH {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d3d9ra1 d.17.4.27 (A:3-134) Uncharacterized protein ECA1476 {Pectobacterium atrosepticum [TaxId: 29471]} Back     information, alignment and structure
>d3b7ca1 d.17.4.16 (A:1-121) Uncharacterized protein SO0125 {Shewanella oneidensis [TaxId: 70863]} Back     information, alignment and structure
>d3bb9a1 d.17.4.16 (A:27-147) Uncharacterized protein Sfri1973 {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d3en8a1 d.17.4.20 (A:1-127) Uncharacterized protein BxeB2092 {Burkholderia xenovorans [TaxId: 36873]} Back     information, alignment and structure
>d3cu3a1 d.17.4.28 (A:9-170) Uncharacterized protein NpunR1993 {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d2owpa1 d.17.4.18 (A:1-128) Hypothetical protein BxeB1374 {Burkholderia xenovorans [TaxId: 36873]} Back     information, alignment and structure
>d1m98a2 d.17.4.6 (A:176-317) Orange carotenoid protein, C-terminal domain {Cyanobacteria (Arthrospira maxima) [TaxId: 129910]} Back     information, alignment and structure
>d2rcda1 d.17.4.18 (A:1-127) Uncharacterized protein ECA3500 {Pectobacterium atrosepticum [TaxId: 29471]} Back     information, alignment and structure
>d2r4ia1 d.17.4.15 (A:1-122) Uncharacterized protein CHU142 {Cytophaga hutchinsonii [TaxId: 985]} Back     information, alignment and structure
>d1s5aa_ d.17.4.10 (A:) Hypothetical protein YesE {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d3dmca1 d.17.4.10 (A:1-133) Uncharacterized protein Ava2261 {Anabaena variabilis [TaxId: 1172]} Back     information, alignment and structure
>d2f86b1 d.17.4.7 (B:343-471) Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d3cnxa1 d.17.4.17 (A:5-157) Uncharacterized protein SAV4671 {Streptomyces avermitilis [TaxId: 33903]} Back     information, alignment and structure
>d1ohpa1 d.17.4.3 (A:1-125) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Comamonas testosteroni, also known as Pseudomonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d2bnga1 d.17.4.8 (A:13-144) Uncharacterized protein Mb2760 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1oh0a_ d.17.4.3 (A:) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1z1sa1 d.17.4.10 (A:1-129) Uncharacterized protein PA3332 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2ux0a1 d.17.4.7 (A:387-521) Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2rgqa1 d.17.4.25 (A:1-133) Uncharacterized protein NpunR3134 {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d3dm8a1 d.17.4.20 (A:1-135) Uncharacterized protein Rpa4348 {Rhodopseudomonas palustris [TaxId: 1076]} Back     information, alignment and structure
>d2chca1 d.17.4.25 (A:1-167) Uncharacterized protein Rv3472 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2a15a1 d.17.4.3 (A:5-136) Hypothetical protein Rv0760c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d3blza1 d.17.4.14 (A:3-126) Uncharacterized protein Sbal0622 {Shewanella baltica [TaxId: 62322]} Back     information, alignment and structure
>d3ebta1 d.17.4.9 (A:1-131) Uncharacterized protein BPSS0132 {Burkholderia pseudomallei [TaxId: 28450]} Back     information, alignment and structure
>d2rfra1 d.17.4.28 (A:1-153) Uncharacterized protein Saro3722 {Novosphingobium aromaticivorans [TaxId: 48935]} Back     information, alignment and structure
>d3b8la1 d.17.4.28 (A:1-144) Uncharacterized protein Saro3538 {Novosphingobium aromaticivorans [TaxId: 48935]} Back     information, alignment and structure
>d3dxoa1 d.17.4.19 (A:1-117) Uncharacterized protein Atu0744 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1nwwa_ d.17.4.8 (A:) Limonene-1,2-epoxide hydrolase {Rhodococcus erythropolis [TaxId: 1833]} Back     information, alignment and structure
>d1tuha_ d.17.4.11 (A:) Hypothetical protein egc068 from a soil-derived mobile gene cassette {uncultured organism [TaxId: 155900]} Back     information, alignment and structure
>d3ec9a1 d.17.4.10 (A:10-139) Uncharacterized protein BTHI0051 {Burkholderia thailandensis [TaxId: 57975]} Back     information, alignment and structure
>d2k54a1 d.17.4.29 (A:1-123) Uncharacterized protein Atu0742 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d3er7a1 d.17.4.24 (A:5-122) Uncharacterized protein Exig0174 {Exiguobacterium sibiricum 255-15 [TaxId: 262543]} Back     information, alignment and structure
>d2gexa1 d.17.4.9 (A:2-139) Nogalamycin biosynthesis protein SnoL {Streptomyces nogalater [TaxId: 38314]} Back     information, alignment and structure
>d2geya1 d.17.4.9 (A:2-145) Putative hydroxylase AclR {Streptomyces galilaeus [TaxId: 33899]} Back     information, alignment and structure
>d3ef8a1 d.17.4.28 (A:1-149) Uncharacterized protein Saro1465 {Novosphingobium aromaticivorans [TaxId: 48935]} Back     information, alignment and structure