Citrus Sinensis ID: 033198


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-----
MAGKEEEPKTEARDELAESLNDLFTSVSAMVKSELQGTNNTLELLEKMNLRVAEEYKGFGDVAAGLRVFVEQLKKKSGSFDEYVQQIDSIEQQVTQFEAVISMLDKYVAVLESKMQSLYQHHPTS
cccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccc
******************SLNDLFTSVSAMVKSELQGTNNTLELLEKMNLRVAEEYKGFGDVAAGLRVFVEQLKKKSGSFDEYVQQIDSIEQQVTQFEAVISMLDKYVAVLESKM**********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAGKEEEPKTEARDELAESLNDLFTSVSAMVKSELQGTNNTLELLEKMNLRVAEEYKGFGDVAAGLRVFVEQLKKKSGSFDEYVQQIDSIEQQVTQFEAVISMLDKYVAVLESKMQSLYQHHPTS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Biogenesis of lysosome-related organelles complex 1 subunit 2 May mediate the vacuolar degradative transport via the intracellular vesicle trafficking from the endosome to the vacuole.confidentF4K657

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1M1J, chain B
Confidence level:probable
Coverage over the Query: 52-119
View the alignment between query and template
View the model in PyMOL

Templates for Structure Prediction

ID ?Alignment Graph ?Confidence Level ? View Alignment and Template ?
Query
2avr, chain Xprobable Alignment | Template Structure