Citrus Sinensis ID: 033214

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-----
MGKMQSFKDEFTFEQRLEESREIIAKYPDRVPVIAERYSKADLPDMEKKKFLVPRDMSVGQFIHILSSRLHLTPGKALFVFVKDTLPQTATLMDSVYESFKDEDGFLYMCYSSEKTFGYERIQTC
ccccccccccccHHHHHHHHHHHHHHccccEEEEEEEccccccccccccEEEEEccccHHHHHHHHccccccccccEEEEEEcccccccccHHHHHHHHccccccCEEEEEcccccccccccccc
*****SF***FTFEQRLEESREIIAKYPDRVPVIAERYSKADL****KKKFLVPRDMSVGQFIHILSSRLHLTPGKALFVFVKDTLPQTATLMDSVYESFKDEDGFLYMCYSSEKTFGYE*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGKMQSFKDEFTFEQRLEESREIIAKYPDRVPVIAERYSKADLPDMEKKKFLVPRDMSVGQFIHILSSRLHLTPGKALFVFVKDTLPQTATLMDSVYESFKDEDGFLYMCYSSEKTFGYERIQTC

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Autophagy-related protein 8i Involved in cytoplasm to vacuole transport (Cvt) vesicles and autophagosomes formation. May mediate the delivery of the vesicles and autophagosomes to the vacuole via the microtubule cytoskeleton.confidentQ9LRP7
Autophagy-related protein 8 Involved in cytoplasm to vacuole transport (Cvt) vesicles and autophagosomes formation. May mediate the delivery of the vesicles and autophagosomes to the vacuole via the microtubule cytoskeleton.probableP0CO54
Autophagy-related protein 8 Involved in autophagy, in the development of aerial hyphae, in pigmentation and in the differentiation of female reproductive organs. May be also involved in cytoplasm to vacuole transport (Cvt) vesicles formation (By similarity). May mediate the delivery of the vesicles and autophagosomes to the vacuole via the microtubule cytoskeleton.probableQ8J282

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2ZJD, chain A
Confidence level:very confident
Coverage over the Query: 2-119
View the alignment between query and template
View the model in PyMOL